DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10321 and ouib

DIOPT Version :9

Sequence 1:NP_001261124.1 Gene:CG10321 / 37464 FlyBaseID:FBgn0034643 Length:855 Species:Drosophila melanogaster
Sequence 2:NP_649822.2 Gene:ouib / 41039 FlyBaseID:FBgn0037618 Length:312 Species:Drosophila melanogaster


Alignment Length:161 Identity:47/161 - (29%)
Similarity:60/161 - (37%) Gaps:27/161 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   625 YICHLCSTEFRQFKGLQNHMHSHTNWIRANCKKQP-QCQICLKSFKGPGMLRMHMKTHDAESSTP 688
            |||.||.|........|.||..|..       ::| .|:.|...|...|.||.|.:.|..|.  |
  Fly   167 YICELCGTHATSKPTFQRHMRKHRG-------ERPFGCKDCDARFLSAGELRAHHRVHTGEQ--P 222

  Fly   689 M-CTICNRTFKSKAILYRHRQTH-QQRAYCCGVANCRKNFSSAVNLKWHV-----ERKHPEVVDP 746
            . |..|.:.:.|......|.:|| ..|.|.|  ..|.|.|::|..||.|:     ||.       
  Fly   223 FACRFCEKRYVSYMGRLIHERTHTNDRPYVC--EECGKKFTTAYVLKNHMVIHTGERN------- 278

  Fly   747 LFKCGECGSLYDNVDSLQLHVESTDHSAEVQ 777
             |:|..|...:.....|..|..|..|...|:
  Fly   279 -FRCDICDRSFQRKAHLVTHTRSMMHLQNVK 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10321NP_001261124.1 zf-AD 12..80 CDD:214871
ASF1_hist_chap <405..516 CDD:304562
C2H2 Zn finger 627..647 CDD:275368 7/19 (37%)
C2H2 Zn finger 661..681 CDD:275368 7/19 (37%)
C2H2 Zn finger 690..710 CDD:275368 4/19 (21%)
C2H2 Zn finger 717..740 CDD:275368 10/27 (37%)
C2H2 Zn finger 750..767 CDD:275368 3/16 (19%)
ouibNP_649822.2 zf-AD 5..78 CDD:214871
COG5048 <158..300 CDD:227381 44/151 (29%)
C2H2 Zn finger 169..189 CDD:275368 7/19 (37%)
C2H2 Zn finger 197..217 CDD:275368 7/19 (37%)
zf-H2C2_2 209..234 CDD:290200 8/26 (31%)
C2H2 Zn finger 225..245 CDD:275368 4/19 (21%)
zf-H2C2_2 241..262 CDD:290200 9/22 (41%)
C2H2 Zn finger 253..273 CDD:275368 8/21 (38%)
zf-H2C2_2 266..288 CDD:290200 8/29 (28%)
C2H2 Zn finger 281..299 CDD:275368 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.