DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10321 and nom

DIOPT Version :9

Sequence 1:NP_001261124.1 Gene:CG10321 / 37464 FlyBaseID:FBgn0034643 Length:855 Species:Drosophila melanogaster
Sequence 2:NP_001262384.1 Gene:nom / 41038 FlyBaseID:FBgn0037617 Length:370 Species:Drosophila melanogaster


Alignment Length:287 Identity:70/287 - (24%)
Similarity:96/287 - (33%) Gaps:48/287 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   538 SSASPTPKRAKRSNHQIPAGVTLEPCDHQPPAAGSTTSSKLAAANS------RQLVQTASVIAAA 596
            |:...|.|| :|...::|    ||..|     ...|..||.:|..|      .|.|:.::...|.
  Fly    99 STKKKTTKR-RRGRPRMP----LEIVD-----IVVTNESKASAGESVGGDEFDQPVEISNEPDAT 153

  Fly   597 GADDNY-EIDANLVTEFIRQHTSPLGSGRYICHLCSTEFRQFKGLQNHMHSHTNWIRANCKKQPQ 660
            .:|.|. |||..........|..| ....:.|..|.........|..|...| |.||..     .
  Fly   154 DSDVNLEEIDLPDEDGLESDHDLP-NVQIHKCDTCGIIKNNKSSLVRHQFEH-NGIRPY-----P 211

  Fly   661 CQICLKSFKGPGMLRMHMKTHDAESSTPMCTICNRTFKSKAILYRHRQTH-QQRAYCCGVANCRK 724
            |:.|.|:|.....|:.|..||........|..|:|.:.|.....:|.:.| .:|.:.|.  .|.|
  Fly   212 CKECPKTFLVASELKAHNLTHHTLEPPFACRYCDRRYFSVVGRKKHERVHTNERPFVCD--QCGK 274

  Fly   725 NFSSAVNLKWH-----VERKHPEVVDPLFKCGECGSLYDNVDSLQLHVESTDHSAEVQISGQDDA 784
            .|:....||.|     |.||        :.|..|...:.....|..|..|..|....:.......
  Fly   275 AFTRTCILKAHMAVHQVVRK--------YSCDVCDRSFSLKKHLATHFISNTHKRNAEAVTSSSE 331

  Fly   785 FSGAVSIVSNGTTDMSNMMATGQGTTL 811
            :...:|..|:.|        ..|||.|
  Fly   332 YMSMLSFESDET--------WSQGTPL 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10321NP_001261124.1 zf-AD 12..80 CDD:214871
ASF1_hist_chap <405..516 CDD:304562
C2H2 Zn finger 627..647 CDD:275368 4/19 (21%)
C2H2 Zn finger 661..681 CDD:275368 6/19 (32%)
C2H2 Zn finger 690..710 CDD:275368 5/19 (26%)
C2H2 Zn finger 717..740 CDD:275368 9/27 (33%)
C2H2 Zn finger 750..767 CDD:275368 3/16 (19%)
nomNP_001262384.1 zf-AD 5..76 CDD:214871
C2H2 Zn finger 184..204 CDD:275368 4/19 (21%)
C2H2 Zn finger 212..261 CDD:275368 13/48 (27%)
zf-H2C2_2 255..278 CDD:290200 7/24 (29%)
C2H2 Zn finger 269..289 CDD:275368 7/21 (33%)
zf-H2C2_2 282..305 CDD:290200 8/30 (27%)
C2H2 Zn finger 297..313 CDD:275368 3/15 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.