DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10321 and ZBTB34

DIOPT Version :9

Sequence 1:NP_001261124.1 Gene:CG10321 / 37464 FlyBaseID:FBgn0034643 Length:855 Species:Drosophila melanogaster
Sequence 2:NP_001382127.1 Gene:ZBTB34 / 403341 HGNCID:31446 Length:514 Species:Homo sapiens


Alignment Length:514 Identity:100/514 - (19%)
Similarity:176/514 - (34%) Gaps:125/514 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 AAQSQFL--PQLLQTPNGQTLQIVQQPNGTQTLQLVQLVPQRSLAPTGVTTVTTTTNATDMGQHV 323
            ||.|.:.  ...|.|.:|.::.:::.||..:.|.......:.||....|.:..|..:...|    
Human    65 AASSPYFRDHSALSTMSGLSISVIKNPNVFEQLLSFCYTGRMSLQLKDVVSFLTAASFLQM---- 125

  Fly   324 GASLGDADVQLLEDGCEVEDEELEDVYEQLDSKADHSFETIVLDDD-QQQDFLKDH--------- 378
                     |.:.|.|   .:.||.::.:: |..|....|:..::: :.::.:||.         
Human   126 ---------QCVIDKC---TQILESIHSKI-SVGDVDSVTVGAEENPESRNGVKDSSFFANPVEI 177

  Fly   379 -----HEHHQVMINEDLTQSESQDHEYFDDLDQQQAMD-----EIEDEEEQMKPEEDQDTFIIEE 433
                 .:..|...:.||....:........|.::...|     .:.:.|.|::.:.:|...::.|
Human   178 SPPYCSQGRQPTASSDLRMETTPSKALRSRLQEEGHSDRGSSGSVSEYEIQIEGDHEQGDLLVRE 242

  Fly   434 IQLED----DEMLDDPDGEEIDQDCEYIGEEQDPHLSGDVDDDLEYSIMEPPDGETSVDIDQAFM 494
            .|:.:    .|..|.|...:                |..:.||..::  |..|||..|.::....
Human   243 SQITEVKVKMEKSDRPSCSD----------------SSSLGDDGYHT--EMVDGEQVVAVNVGSY 289

  Fly   495 DSEQSHHQQHQEEMQSISLENAVVEFSQATTTTEALVGPTMTVSSASPTPK-----RAKRSNHQI 554
            .|...|...:.:..            ||.|..:||.    .::|::||:..     |..|:..:.
Human   290 GSVLQHAYSYSQAA------------SQPTNVSEAF----GSLSNSSPSRSMLSCFRGGRARQKR 338

  Fly   555 PAGVTLEPCDHQPPAAGSTTSSKLAAANSRQLVQTASVIAAAGADDNYEIDANLVTEFIRQHTSP 619
            ...|.|. .|.|....||.:.:.:                     :|...:::......|.|..|
Human   339 ALSVHLH-SDLQGLVQGSDSEAMM---------------------NNPGYESSPRERSARGHWYP 381

  Fly   620 LGSGRYICHLCSTEFRQFKGLQNHMHSH---TNWIRANCKKQPQCQICLKSFKGPGMLRMHMKTH 681
            ... |.||..|...|.|...|..||..|   |.::         |:.|.|.:.....|..|::.|
Human   382 YNE-RLICIYCGKSFNQKGSLDRHMRLHMGITPFV---------CKFCGKKYTRKDQLEYHIRGH 436

  Fly   682 DAESSTPMCTICNRTFKSKAILYRH-RQTHQQRAYCCGVANCRKNFSSAVNLKWHVERK 739
             .:.....|.||.:.|..:..|.:| |:.|.      |||..|....|......:||:|
Human   437 -TDDKPFRCEICGKCFPFQGTLNQHLRKNHP------GVAEVRSRIESPERTDVYVEQK 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10321NP_001261124.1 zf-AD 12..80 CDD:214871
ASF1_hist_chap <405..516 CDD:304562 19/119 (16%)
C2H2 Zn finger 627..647 CDD:275368 7/19 (37%)
C2H2 Zn finger 661..681 CDD:275368 5/19 (26%)
C2H2 Zn finger 690..710 CDD:275368 7/20 (35%)
C2H2 Zn finger 717..740 CDD:275368 8/23 (35%)
C2H2 Zn finger 750..767 CDD:275368
ZBTB34NP_001382127.1 BTB_POZ_ZBTB34 21..140 CDD:349529 19/90 (21%)
C2H2 Zn finger 388..408 CDD:275368 7/19 (37%)
zf-H2C2_2 400..425 CDD:404364 8/33 (24%)
C2H2 Zn finger 416..436 CDD:275368 5/19 (26%)
zf-H2C2_2 429..451 CDD:404364 6/22 (27%)
zf-C2H2 442..463 CDD:395048 6/20 (30%)
C2H2 Zn finger 444..462 CDD:275368 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24399
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.