DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG10321 and hnrnpa0l

DIOPT Version :9

Sequence 1:	NP_001261124.1	Gene:	CG10321 / 37464	FlyBaseID:	FBgn0034643	Length:	855	Species:	Drosophila melanogaster
Sequence 2:	NP_001268650.1	Gene:	hnrnpa0l / 321899	ZFINID:	ZDB-GENE-030131-618	Length:	302	Species:	Danio rerio

Alignment Length:	78	Identity:	21/78 - (26%)
Similarity:	34/78 - (43%)	Gaps:	18/78 - (23%)

- Green bases have known domain annotations that are detailed below.

  Fly   335 LEDGCEVEDEELEDVYEQL------------DSKADHSFETIVLDDDQQQD---FLKDHHE-HHQ 383
            |:|  ::|||.|:|.:.|.            |:.....|..:..||:...|   .:|.|.. .|:
Zfish   104 LKD--DIEDEHLQDYFSQFGPIEKAQVITDKDTGKKRGFGFVYFDDNDSADKAVVMKFHSICGHK 166

  Fly   384 VMINEDLTQSESQ 396
            |.:.:.||:.|.|
Zfish   167 VEVKKALTKQEMQ 179

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG10321	NP_001261124.1	zf-AD	12..80	CDD:214871
		ASF1_hist_chap	<405..516	CDD:304562
		C2H2 Zn finger	627..647	CDD:275368
		C2H2 Zn finger	661..681	CDD:275368
		C2H2 Zn finger	690..710	CDD:275368
		C2H2 Zn finger	717..740	CDD:275368
		C2H2 Zn finger	750..767	CDD:275368
hnrnpa0l	NP_001268650.1	RRM1_hnRNPA0	4..82	CDD:240772
hnrnpa0l	NP_001268650.1	RRM_SF	98..177	CDD:302621	19/74 (26%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR24399
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	1.100