DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10321 and CG11696

DIOPT Version :9

Sequence 1:NP_001261124.1 Gene:CG10321 / 37464 FlyBaseID:FBgn0034643 Length:855 Species:Drosophila melanogaster
Sequence 2:NP_572731.1 Gene:CG11696 / 32104 FlyBaseID:FBgn0030314 Length:664 Species:Drosophila melanogaster


Alignment Length:467 Identity:94/467 - (20%)
Similarity:151/467 - (32%) Gaps:170/467 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   373 DFLKDHHEHHQVMINEDLTQSESQDHEYFDDLDQQQAMDEIEDEEEQMKPE-------------- 423
            |.:|||.....|:  :.|:..:.:|.:|.|..:.....:...||||:.:|:              
  Fly   119 DDIKDHILCEPVI--DALSAGDEKDSDYGDTFEPDFEPESQPDEEEEPEPDPVKPRPRGRPRKTA 181

  Fly   424 ---------------EDQDTFIIEEIQLEDD-----EMLDDPDGEEIDQDCEYIGEEQDPHLSGD 468
                           :.|:...|.|:.|.:.     |:.....|.|.|||             ||
  Fly   182 LQQTHQIIKRKYEKRKQQNKAKITELSLRESRARQRELKRSSAGAEDDQD-------------GD 233

  Fly   469 VDDDLEYSIMEPPDGETSVDIDQAFMDSEQSHHQQHQEEMQSISLENAVVEFSQATTTTEALVGP 533
            .|::.|    |...||.:.|.|:                                          
  Fly   234 EDEEDE----EDVGGELTPDADE------------------------------------------ 252

  Fly   534 TMTVSSASPTPKRAKRSNHQIPAGVTLEPCDHQPPAAGSTTSSKLAAANSRQLVQTASVIAAAGA 598
                   .|.| |.||...:....||.:..|       .|:...:..::.:::            
  Fly   253 -------QPKP-RGKRGRPKTKKLVTADDND-------DTSEVPVKRSSIKEM------------ 290

  Fly   599 DDNYEIDANLVTEFIRQHTSPLGSGRYICHLCSTEFRQFKGLQNHM---HSHTNWIRA------- 653
             |:| |.||:..:               |.:|:.....|..|:.|.   |..|.:::.       
  Fly   291 -DDY-IAANVKLD---------------CAICAAPLEDFNDLKRHFRVEHDCTGYVKCCNNRYKK 338

  Fly   654 --------NCKKQPQ---CQICLKSFKGPGMLRMHM-KTHDAESS-TPMCTICNRTFKSKAILYR 705
                    :|.|.||   ||.|.|:|.......||| :.|..:.. ...|.||...|..|.:|..
  Fly   339 RTLYVDHLHCHKDPQYFSCQSCRKNFLNRNSQVMHMLRFHSQQQELVHQCAICEARFAKKFLLTM 403

  Fly   706 HRQTHQ--QRAYCCGVANCRKNFSSAVNLKWHVERKHPEVVDPLFKCGECGSLYDNVDSLQLHVE 768
            |.:.|:  :|...|.  .|.|.|.:...|..||:|.|.....|:. |..||:.:.:..:..:|.:
  Fly   404 HLKGHKGTERPEVCD--TCSKTFRTKFELSAHVKRMHAADFTPII-CDICGTHFRSKANFLIHKK 465

  Fly   769 STDHS---AEVQ 777
            :....   ||||
  Fly   466 ALHPDGPVAEVQ 477

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10321NP_001261124.1 zf-AD 12..80 CDD:214871
ASF1_hist_chap <405..516 CDD:304562 24/144 (17%)
C2H2 Zn finger 627..647 CDD:275368 6/22 (27%)
C2H2 Zn finger 661..681 CDD:275368 8/20 (40%)
C2H2 Zn finger 690..710 CDD:275368 7/19 (37%)
C2H2 Zn finger 717..740 CDD:275368 8/22 (36%)
C2H2 Zn finger 750..767 CDD:275368 3/16 (19%)
CG11696NP_572731.1 zf-AD 2..78 CDD:285071
C2H2 Zn finger 332..349 CDD:275368 0/16 (0%)
C2H2 Zn finger 357..378 CDD:275368 8/20 (40%)
C2H2 Zn finger 388..408 CDD:275368 7/19 (37%)
C2H2 Zn finger 417..438 CDD:275368 8/22 (36%)
C2H2 Zn finger 447..465 CDD:275368 4/17 (24%)
C2H2 Zn finger 478..498 CDD:275368 94/467 (20%)
C2H2 Zn finger 509..529 CDD:275368
C2H2 Zn finger 537..557 CDD:275368
C2H2 Zn finger 565..583 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.