DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10321 and Zbtb26

DIOPT Version :9

Sequence 1:NP_001261124.1 Gene:CG10321 / 37464 FlyBaseID:FBgn0034643 Length:855 Species:Drosophila melanogaster
Sequence 2:NP_001101310.1 Gene:Zbtb26 / 311910 RGDID:1308561 Length:451 Species:Rattus norvegicus


Alignment Length:465 Identity:92/465 - (19%)
Similarity:155/465 - (33%) Gaps:137/465 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   363 TIVLDDDQQQ----------DFLKDHHEHHQVMINE------DLTQSESQDHEYFDDLDQQQAMD 411
            |:::||.:.|          .||:|     |.::|:      .:.||.....:..  |.....:.
  Rat    47 TVLIDDVEVQGHKIVFAAGSPFLRD-----QFLLNDSREVKISILQSSEVGRQLL--LSCYSGVL 104

  Fly   412 EIEDEEEQMKPEED-----------QDTFIIEEIQ------LEDDEMLDDPDGEEIDQDCEYIGE 459
            |.        ||.:           |.:.|:|...      ::..:.:|..:|.| .|......:
  Rat   105 EF--------PEMELVNYLTAASFLQMSHIVERCTQALWKFIKPKQPMDSKEGSE-PQSASPQSK 160

  Fly   460 EQDPHLSGDVDDDLEYSIMEPPDGETSVDIDQAFMDSEQSHHQQHQEEMQSISLENAVVEFSQAT 524
            ||.....|....||  ..:.|.:..         ||.|.|       ::|.:.:|          
  Rat   161 EQQGDARGSPKQDL--PCIHPSEDS---------MDMEDS-------DIQIVKVE---------- 197

  Fly   525 TTTEALVGPTMTVSSASPTPKRAKRSNHQIPAGVTLEP-----CDHQPPAAGSTTSSKLAAANSR 584
                         |....:..|:|:..:|.   ::.||     .:.|.....||..:::...:..
  Rat   198 -------------SIGDVSEDRSKKDQNQY---ISSEPTALHSSEPQHSLINSTVENRVNELDQS 246

  Fly   585 QLVQTASVIAAAGADDNYEIDANLVTEFIRQHTSPLGSGRYICHLCSTEFRQFKGLQNHMHSHTN 649
            .|...|  ::..|.||......::....||.....| ...:.|..|:..||..:...||:..|  
  Rat   247 HLHNYA--LSYTGNDDIIMTSKDVFGPNIRGVDKGL-QWHHQCPKCTRVFRHLENYANHLKMH-- 306

  Fly   650 WIRANCKKQPQCQICLKSFKGPGMLRMHMKTHDAESSTPMCTICNRTFKSKAILYRHRQTHQ-QR 713
                   |...|.:|.|:|...|.|..||:.| |......|.||.:||..|..|..|...|. .:
  Rat   307 -------KLFMCLLCGKTFTQKGNLHRHMRVH-AGIKPFQCKICGKTFSQKCSLQDHLNLHSGDK 363

  Fly   714 AYCCGVANCRKNFSSAVNLKWHVERKHPEVVDPLFKCGECGSLYDN-----VDSLQLHVES---- 769
            .:.|..  |...|:....|:.|:::.|.:            :.:||     |..|.:..:|    
  Rat   364 PHKCNY--CDMVFAHKPVLRKHLKQLHGK------------NSFDNANERSVQDLTVDFDSFACT 414

  Fly   770 --TDHSAEVQ 777
              ||.:.:.|
  Rat   415 TVTDSNCQPQ 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10321NP_001261124.1 zf-AD 12..80 CDD:214871
ASF1_hist_chap <405..516 CDD:304562 22/127 (17%)
C2H2 Zn finger 627..647 CDD:275368 6/19 (32%)
C2H2 Zn finger 661..681 CDD:275368 8/19 (42%)
C2H2 Zn finger 690..710 CDD:275368 8/19 (42%)
C2H2 Zn finger 717..740 CDD:275368 5/22 (23%)
C2H2 Zn finger 750..767 CDD:275368 4/21 (19%)
Zbtb26NP_001101310.1 BTB 34..134 CDD:279045 18/101 (18%)
BTB 45..138 CDD:197585 18/105 (17%)
C2H2 Zn finger 286..306 CDD:275368 6/19 (32%)
zf-C2H2 309..331 CDD:278523 8/21 (38%)
C2H2 Zn finger 311..331 CDD:275368 8/19 (42%)
zf-H2C2_2 326..348 CDD:290200 9/22 (41%)
C2H2 Zn finger 339..359 CDD:275368 8/19 (42%)
zf-H2C2_2 351..376 CDD:290200 6/26 (23%)
C2H2 Zn finger 367..385 CDD:275368 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24399
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.