DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10321 and Zbtb2

DIOPT Version :9

Sequence 1:NP_001261124.1 Gene:CG10321 / 37464 FlyBaseID:FBgn0034643 Length:855 Species:Drosophila melanogaster
Sequence 2:NP_001100930.1 Gene:Zbtb2 / 308126 RGDID:1306621 Length:514 Species:Rattus norvegicus


Alignment Length:416 Identity:78/416 - (18%)
Similarity:125/416 - (30%) Gaps:118/416 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   489 IDQAFMDSEQSHHQQHQEEMQSISLENAVVEFSQATTTTEALVGPTMTVSSASPTPKRAKRSNHQ 553
            |.:|.:.|:.:.....|....:.||....:...|....|:..:||...  ...|.|:.::.:...
  Rat   108 IQEASLASQGTFSHPEQVFPLASSLYGIQIADHQLRQATKMNLGPEKL--GREPRPQASRMNQEP 170

  Fly   554 IPAGVTLEPCDH---QPPAAGSTTSSKLAAANSRQLVQTASVIAAAGADDNYEIDAN--LVTEFI 613
            :|....|.....   |......|.:..|..:.|.:||.|.......|.:.|.|..::  ..:...
  Rat   171 VPETSQLSQLTSNLAQVNRTNMTPADPLQTSLSPELVSTPVPPPPPGEETNLEASSSDEQPSSLT 235

  Fly   614 RQHTSPLGSGR-------YICHLCSTEFRQFKGLQNHMHSHTNWIRANCKKQPQCQICLKSFKGP 671
            ..|..|....|       |.||||...|.....|:.|:..||.               :....||
  Rat   236 IAHVKPSIMKRNGSFPKYYACHLCGRRFTLRSSLREHLQIHTG---------------VPFTAGP 285

  Fly   672 ---------------------------GMLRMHMKTH---------DAESSTP------------ 688
                                       ||:......|         ..:|.||            
  Rat   286 PGEGRGPLSLCSNAADLGKDALEVPEAGMISDSELQHISDSPIIDGQQQSETPPPSDIADIDNLE 350

  Fly   689 -------------MCTICNRTFKSKAILYRHRQTHQQRAYCCGVANCRKNFSSAVNLKWHVERKH 740
                         .||||.|.|..|:....|...|..:.:.|  :.|.|:|..|.....||    
  Rat   351 QADQEREVKRRKYECTICGRKFIQKSHWREHMYIHTGKPFKC--STCDKSFCRANQAARHV---- 409

  Fly   741 PEVVDPLFKC-GECGSLYDNVDSLQLHVESTDHSAE-----VQISGQ------DDAFSGAVSIVS 793
                     | .:....|..||...|.:.:.:..::     ||.:..      |..||....:|.
  Rat   410 ---------CLNQSIDTYTMVDKQTLELCTFEEGSQMDNMLVQANKPYKCNLCDKTFSTPNEVVK 465

  Fly   794 NGTTDM-SNMMATGQGTTLAGGTGDT 818
            :...:. |::.|..:|.::..|:||:
  Rat   466 HSCQNQNSDVFALDEGRSVLLGSGDS 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10321NP_001261124.1 zf-AD 12..80 CDD:214871
ASF1_hist_chap <405..516 CDD:304562 6/26 (23%)
C2H2 Zn finger 627..647 CDD:275368 7/19 (37%)
C2H2 Zn finger 661..681 CDD:275368 4/46 (9%)
C2H2 Zn finger 690..710 CDD:275368 8/19 (42%)
C2H2 Zn finger 717..740 CDD:275368 7/22 (32%)
C2H2 Zn finger 750..767 CDD:275368 5/17 (29%)
Zbtb2NP_001100930.1 BTB_POZ_ZBTB2 3..117 CDD:349502 3/8 (38%)
zf-C2H2 254..276 CDD:395048 8/21 (38%)
C2H2 Zn finger 256..276 CDD:275368 7/19 (37%)
zf-C2H2 363..385 CDD:395048 8/21 (38%)
C2H2 Zn finger 365..385 CDD:275368 8/19 (42%)
zf-H2C2_2 377..399 CDD:404364 5/23 (22%)
C2H2 Zn finger 392..416 CDD:275368 8/38 (21%)
C2H2 Zn finger 450..466 CDD:275368 4/15 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24399
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.