| Sequence 1: | NP_001261124.1 | Gene: | CG10321 / 37464 | FlyBaseID: | FBgn0034643 | Length: | 855 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_006251354.1 | Gene: | Patz1 / 305471 | RGDID: | 1308337 | Length: | 687 | Species: | Rattus norvegicus |
| Alignment Length: | 331 | Identity: | 77/331 - (23%) |
|---|---|---|---|
| Similarity: | 109/331 - (32%) | Gaps: | 99/331 - (29%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 528 EALVGPTMTVSSASP--TPKRA----KRSN----------------------------------- 551
Fly 552 HQIPAGVT---LEPCDHQPPAAGS-----TTSSKLAAANSRQLVQTASVIAAAGADDNYEIDANL 608
Fly 609 VTEFIRQHTSPLGSGRYICHLCSTEFRQFKGLQNHMHSHTNWIRANCKKQPQCQICLKSFKGPGM 673
Fly 674 LRMHMKTHDAESSTPMCTICNRTFKSKAILYRHRQTHQQRAYC--CG------------------ 718
Fly 719 ----VANCRKNFSSAVNLKWHVERKH----PEV---VDPLFKCG---ECGSLYDNVD----SLQL 765
Fly 766 HVESTD 771 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG10321 | NP_001261124.1 | zf-AD | 12..80 | CDD:214871 | |
| ASF1_hist_chap | <405..516 | CDD:304562 | |||
| C2H2 Zn finger | 627..647 | CDD:275368 | 4/19 (21%) | ||
| C2H2 Zn finger | 661..681 | CDD:275368 | 9/19 (47%) | ||
| C2H2 Zn finger | 690..710 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 717..740 | CDD:275368 | 11/44 (25%) | ||
| C2H2 Zn finger | 750..767 | CDD:275368 | 6/23 (26%) | ||
| Patz1 | XP_006251354.1 | BTB | 30..157 | CDD:279045 | |
| BTB | 42..159 | CDD:197585 | |||
| C2H2 Zn finger | 294..314 | CDD:275368 | 1/19 (5%) | ||
| C2H2 Zn finger | 357..377 | CDD:275368 | 4/27 (15%) | ||
| zf-H2C2_2 | 369..394 | CDD:290200 | 7/32 (22%) | ||
| COG5048 | <381..518 | CDD:227381 | 36/140 (26%) | ||
| C2H2 Zn finger | 385..405 | CDD:275368 | 4/19 (21%) | ||
| C2H2 Zn finger | 415..433 | CDD:275368 | 8/17 (47%) | ||
| zf-C2H2_6 | 442..467 | CDD:290623 | 7/24 (29%) | ||
| C2H2 Zn finger | 444..464 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 497..517 | CDD:275368 | 9/19 (47%) | ||
| zf-C2H2_assoc3 | 536..604 | CDD:293243 | 9/28 (32%) | ||
| COG4049 | 600..>635 | CDD:226535 | |||
| C2H2 Zn finger | 607..628 | CDD:275368 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR24399 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||