DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10321 and ZBTB20

DIOPT Version :9

Sequence 1:NP_001261124.1 Gene:CG10321 / 37464 FlyBaseID:FBgn0034643 Length:855 Species:Drosophila melanogaster
Sequence 2:NP_001157814.1 Gene:ZBTB20 / 26137 HGNCID:13503 Length:741 Species:Homo sapiens


Alignment Length:640 Identity:133/640 - (20%)
Similarity:213/640 - (33%) Gaps:205/640 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 LLQTPNGQTLQIVQQPNGTQTLQLVQLVPQRSLAPTGVTTVTTTTNATDMGQHVGASLGDADVQL 334
            :|:....:.|||:   .....||:..::.:        .|...:.|..|:...:..|..|.....
Human   162 VLRVSQSEALQIL---TAASILQIKTVIDE--------CTRIVSQNVGDVFPGIQDSGQDTPRGT 215

  Fly   335 LEDGCEVEDEELEDVYEQLDSKADHSFETI--------VLDDDQQQDF----LKDHHE------- 380
            .|.|...:..:.|..|  |.|...||.:.|        :.:...::.|    :..|||       
Human   216 PESGTSGQSSDTESGY--LQSHPQHSVDRIYSALYACSMQNGSGERSFYSGAVVSHHETALGLPR 278

  Fly   381 -HHQVMINED------LTQSESQDHEYFDDLDQ-------------QQAMDEIEDEEEQMKPEED 425
             ||.    ||      :.:...|...|.....:             |..:..|..::|.   |:|
Human   279 DHHM----EDPSWITRIHERSQQMERYLSTTPETTHCRKQPRPVRIQTLVGNIHIKQEM---EDD 336

  Fly   426 QDTFIIEEIQL----EDDEMLDDPDGEEIDQDCEYIGEEQDPHLSGD-VDDDLEYSIMEPPDGET 485
            .|.:..:.:|:    |.:|..:|.|..|        |.|.:|  .|: .|..:..||...||   
Human   337 YDYYGQQRVQILERNESEECTEDTDQAE--------GTESEP--KGESFDSGVSSSIGTEPD--- 388

  Fly   486 SVDIDQAF-----MDSEQSHHQQHQ----------------------EEMQSISLENAVVEFSQA 523
              .::|.|     .||:....|..|                      |....:.:::.|:..|.:
Human   389 --SVEQQFGPGAARDSQAEPTQPEQAAEAPAEGGPQTNQLETGASSPERSNEVEMDSTVITVSNS 451

  Fly   524 TTTTEALVGPTMTVSSASPTPKR------------------AKRSNHQI---------PAGVTLE 561
            :..: .|..|::..|...|.|..                  ...||.|:         ||..|.:
Human   452 SDKS-VLQQPSVNTSIGQPLPSTQLYLRQTETLTSNLRMPLTLTSNTQVIGTAGNTYLPALFTTQ 515

  Fly   562 PCDHQP---------PAAGS-----TTSSKLAAANSRQLVQTASVIAAAGADDNYEIDANLVTEF 612
            |....|         |.||.     |.|....:..:.||.....:.::||               
Human   516 PAGSGPKPFLFSLPQPLAGQQTQFVTVSQPGLSTFTAQLPAPQPLASSAG--------------- 565

  Fly   613 IRQHTSPLGSGR---YICHLCSTEFRQFKGLQNHMHSHTNWIRANCKKQPQCQICLKSFKGPGML 674
               |::..|.|.   |.|.||:..|...:....||..||.      :|..||.||.:||.....|
Human   566 ---HSTASGQGEKKPYECTLCNKTFTAKQNYVKHMFVHTG------EKPHQCSICWRSFSLKDYL 621

  Fly   675 RMHMKTHDAESSTPMCTICNRTFKSKAILYRHRQTHQ-QRAYCCGVANCRKNFSSAVNLKWHV-- 736
            ..||.||....:. .|:|||:.|..|:.|..|.:.|: :::|.|.:  |:|.||....|:.||  
Human   622 IKHMVTHTGVRAY-QCSICNKRFTQKSSLNVHMRLHRGEKSYECYI--CKKKFSHKTLLERHVAL 683

  Fly   737 ----------------ERKHPEVV----DPLFKCGECGSLYDNV----DSLQLHV 767
                            ....|.||    ...:.|..|.:.:|.:    |.:::||
Human   684 HSASNGTPPAGTPPGARAGPPGVVACTEGTTYVCSVCPAKFDQIEQFNDHMRMHV 738

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10321NP_001261124.1 zf-AD 12..80 CDD:214871
ASF1_hist_chap <405..516 CDD:304562 28/155 (18%)
C2H2 Zn finger 627..647 CDD:275368 6/19 (32%)
C2H2 Zn finger 661..681 CDD:275368 8/19 (42%)
C2H2 Zn finger 690..710 CDD:275368 8/19 (42%)
C2H2 Zn finger 717..740 CDD:275368 8/40 (20%)
C2H2 Zn finger 750..767 CDD:275368 4/20 (20%)
ZBTB20NP_001157814.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
BTB_POZ_ZBTB20_DPZF 79..195 CDD:349517 7/43 (16%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..235 7/33 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 350..440 21/104 (20%)
PHA03169 <352..>442 CDD:223003 21/104 (20%)
Med15 <378..>571 CDD:312941 36/216 (17%)
zf-C2H2 578..600 CDD:395048 7/21 (33%)
C2H2 Zn finger 580..600 CDD:275368 6/19 (32%)
SUF4-like 608..>657 CDD:411020 18/49 (37%)
C2H2 Zn finger 608..629 CDD:411020 9/20 (45%)
C2H2 Zn finger 608..628 CDD:275368 8/19 (42%)
zf-C2H2 634..656 CDD:395048 8/22 (36%)
C2H2 Zn finger 636..656 CDD:411020 8/19 (42%)
C2H2 Zn finger 636..656 CDD:275368 8/19 (42%)
zf-H2C2_2 648..673 CDD:404364 8/26 (31%)
C2H2 Zn finger 664..684 CDD:275368 8/21 (38%)
C2H2 Zn finger 717..737 CDD:275368 4/19 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24399
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.