DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10321 and Zbtb34

DIOPT Version :9

Sequence 1:NP_001261124.1 Gene:CG10321 / 37464 FlyBaseID:FBgn0034643 Length:855 Species:Drosophila melanogaster
Sequence 2:NP_001078976.1 Gene:Zbtb34 / 241311 MGIID:2685195 Length:518 Species:Mus musculus


Alignment Length:514 Identity:96/514 - (18%)
Similarity:176/514 - (34%) Gaps:125/514 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   261 AAQSQFL--PQLLQTPNGQTLQIVQQPNGTQTLQLVQLVPQRSLAPTGVTTVTTTTNATDMGQHV 323
            ||.|.:.  ...|.|.:|.::.:::.|:..:.|.......:.||....|.:..|..:...|    
Mouse    69 AASSPYFRDHSALSTMSGLSISVIKNPSVFEQLLSFCYTGRMSLQLKDVVSFLTAASFLQM---- 129

  Fly   324 GASLGDADVQLLEDGCEVEDEELEDVYEQLDSKADHSFETIVLDDD-QQQDFLKDHH-------- 379
                     |.:.|.|   .:.||.::.:: |..|....||..::: :.::.:||..        
Mouse   130 ---------QCVIDKC---TQILESIHSKI-SVGDVDSVTIGAEENPESRNGVKDGSFFTNPVEI 181

  Fly   380 ------EHHQVMINEDLTQSESQDHEYFDDLDQQQAMD-----EIEDEEEQMKPEEDQDTFIIEE 433
                  :..|..::.||....:.:......|.::...|     .:.:.|.|::.:.:|...::.|
Mouse   182 SPPYCPQVRQPPVSSDLRMETTPNKALRSRLQEEGHSDRGSSGSVSEYEIQIEGDHEQGDLLVRE 246

  Fly   434 IQLED----DEMLDDPDGEEIDQDCEYIGEEQDPHLSGDVDDDLEYSIMEPPDGETSVDIDQAFM 494
            .|:.:    .|..|.|...:                |..:.||..::  |..|||..|.::....
Mouse   247 SQITEVKVKMEKSDRPSCSD----------------SSSLGDDGYHT--EMVDGEQVVAVNVGAY 293

  Fly   495 DSEQSHHQQHQEEMQSISLENAVVEFSQATTTTEALVGPTMTVSSASPTPK-----RAKRSNHQI 554
            .|...|...:.:..            ||.::..||..|.|    ::||:..     |.:.:..:.
Mouse   294 GSVLQHAYPYSQTA------------SQPSSVPEAFGGQT----NSSPSRSMLSCFRGRGARQKR 342

  Fly   555 PAGVTLEPCDHQPPAAGSTTSSKLAAANSRQLVQTASVIAAAGADDNYEIDANLVTEFIRQHTSP 619
            ...|.|. .|.|....||.:.:.:                     :|...:::......|.:..|
Mouse   343 ALSVHLH-SDLQGVVQGSDSEAMM---------------------NNPGYESSPRERSARGYWYP 385

  Fly   620 LGSGRYICHLCSTEFRQFKGLQNHMHSH---TNWIRANCKKQPQCQICLKSFKGPGMLRMHMKTH 681
            ... |.||..|...|.|...|..||..|   |.::         |:.|.|.:.....|..|::.|
Mouse   386 YNE-RLICIYCGKSFNQKGSLDRHMRLHMGITPFV---------CKFCGKKYTRKDQLEYHIRGH 440

  Fly   682 DAESSTPMCTICNRTFKSKAILYRH-RQTHQQRAYCCGVANCRKNFSSAVNLKWHVERK 739
             .:.....|.:|.:.|..:..|.:| |:.|.      ||...|....|......:||:|
Mouse   441 -TDDKPFRCEVCGKCFPFQGTLNQHLRKNHP------GVTEGRGRMESPERTDMYVEQK 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10321NP_001261124.1 zf-AD 12..80 CDD:214871
ASF1_hist_chap <405..516 CDD:304562 19/119 (16%)
C2H2 Zn finger 627..647 CDD:275368 7/19 (37%)
C2H2 Zn finger 661..681 CDD:275368 5/19 (26%)
C2H2 Zn finger 690..710 CDD:275368 6/20 (30%)
C2H2 Zn finger 717..740 CDD:275368 7/23 (30%)
C2H2 Zn finger 750..767 CDD:275368
Zbtb34NP_001078976.1 BTB_POZ_ZBTB34 25..144 CDD:349529 18/90 (20%)
ZnF_C2H2 390..412 CDD:197676 8/21 (38%)
C2H2 Zn finger 392..412 CDD:275368 7/19 (37%)
zf-H2C2_2 404..429 CDD:404364 8/33 (24%)
C2H2 Zn finger 420..440 CDD:275368 5/19 (26%)
zf-H2C2_2 433..455 CDD:404364 5/22 (23%)
zf-C2H2 446..467 CDD:395048 5/20 (25%)
C2H2 Zn finger 448..466 CDD:275368 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24399
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.