Sequence 1: | NP_001261124.1 | Gene: | CG10321 / 37464 | FlyBaseID: | FBgn0034643 | Length: | 855 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_055138.2 | Gene: | PATZ1 / 23598 | HGNCID: | 13071 | Length: | 687 | Species: | Homo sapiens |
Alignment Length: | 331 | Identity: | 77/331 - (23%) |
---|---|---|---|
Similarity: | 110/331 - (33%) | Gaps: | 99/331 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 528 EALVGPTMTVSSASP--TPKRA----KRSN----------------------------------- 551
Fly 552 HQIPAGVT---LEPCDHQPPAAGS-----TTSSKLAAANSRQLVQTASVIAAAGADDNYEIDANL 608
Fly 609 VTEFIRQHTSPLGSGRYICHLCSTEFRQFKGLQNHMHSHTNWIRANCKKQPQCQICLKSFKGPGM 673
Fly 674 LRMHMKTHDAESSTPMCTICNRTFKSKAILYRHRQTHQQRAYC--CG------------------ 718
Fly 719 ----VANCRKNFSSAVNLKWHVERKH----PEV---VDPLFKCG---ECGSLYDNVD----SLQL 765
Fly 766 HVESTD 771 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10321 | NP_001261124.1 | zf-AD | 12..80 | CDD:214871 | |
ASF1_hist_chap | <405..516 | CDD:304562 | |||
C2H2 Zn finger | 627..647 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 661..681 | CDD:275368 | 9/19 (47%) | ||
C2H2 Zn finger | 690..710 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 717..740 | CDD:275368 | 11/44 (25%) | ||
C2H2 Zn finger | 750..767 | CDD:275368 | 6/23 (26%) | ||
PATZ1 | NP_055138.2 | BTB_POZ_ZBTB19_PATZ1 | 14..162 | CDD:349516 | |
A-T hook domain | 264..272 | 2/7 (29%) | |||
Zn finger DNA binding domain | 294..628 | 68/282 (24%) | |||
C2H2 Zn finger | 294..314 | CDD:275368 | 1/19 (5%) | ||
C2H2 Zn finger | 357..377 | CDD:275368 | 4/27 (15%) | ||
zf-C2H2 | 357..377 | CDD:395048 | 4/27 (15%) | ||
COG5048 | <381..518 | CDD:227381 | 36/140 (26%) | ||
C2H2 Zn finger | 385..405 | CDD:275368 | 4/19 (21%) | ||
C2H2 Zn finger | 415..433 | CDD:275368 | 8/17 (47%) | ||
C2H2 Zn finger | 444..464 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 497..517 | CDD:275368 | 9/19 (47%) | ||
zf-C2H2_assoc3 | 536..604 | CDD:406930 | 9/28 (32%) | ||
C2H2 Zn finger | 607..628 | CDD:275370 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24399 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |