DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10321 and Zfp958

DIOPT Version :9

Sequence 1:NP_001261124.1 Gene:CG10321 / 37464 FlyBaseID:FBgn0034643 Length:855 Species:Drosophila melanogaster
Sequence 2:NP_001355333.1 Gene:Zfp958 / 233987 MGIID:2385298 Length:489 Species:Mus musculus


Alignment Length:163 Identity:50/163 - (30%)
Similarity:76/163 - (46%) Gaps:18/163 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   614 RQHTSPLGSGRYICHLCSTEFRQFKGLQNHMHSHTNWIRANCKKQPQCQICLKSFKGPGMLRMHM 678
            |.||   |...|.|:.|...|.....|:.|..:||.      :|..:|..|.|:||....||:|.
Mouse   285 RTHT---GEKPYECNQCGKAFSDHHTLRIHERAHTG------EKPFECNQCGKTFKLHSQLRIHK 340

  Fly   679 KTHDAESSTPMCTICNRTFKSKAILYRHRQTHQ-QRAYCCGVANCRKNFSSAVNLKWHVERKHPE 742
            :||..|.... |..|.:||...:...:|::.|. ::.|.|.  .|.|.|:....|:.| ||.|  
Mouse   341 RTHTGEKPHE-CNQCGKTFACPSSFQKHKRIHTGEKPYECN--QCLKAFAYHSRLRKH-ERTH-- 399

  Fly   743 VVDPLFKCGECGSLYDNVDSLQLHVESTDHSAE 775
            ..:..|:|.:||.::...:|||:|..:  |:.|
Mouse   400 TGEKPFRCNQCGKIFSQSNSLQVHKRT--HTGE 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10321NP_001261124.1 zf-AD 12..80 CDD:214871
ASF1_hist_chap <405..516 CDD:304562
C2H2 Zn finger 627..647 CDD:275368 5/19 (26%)
C2H2 Zn finger 661..681 CDD:275368 8/19 (42%)
C2H2 Zn finger 690..710 CDD:275368 5/19 (26%)
C2H2 Zn finger 717..740 CDD:275368 8/22 (36%)
C2H2 Zn finger 750..767 CDD:275368 6/16 (38%)
Zfp958NP_001355333.1 KRAB 26..66 CDD:334504
C2H2 Zn finger 103..119 CDD:275368
COG5048 125..484 CDD:227381 50/163 (31%)
C2H2 Zn finger 127..147 CDD:275368
C2H2 Zn finger 155..175 CDD:275368
C2H2 Zn finger 183..203 CDD:275368
C2H2 Zn finger 211..231 CDD:275368
C2H2 Zn finger 239..259 CDD:275368
C2H2 Zn finger 267..287 CDD:275368 1/1 (100%)
C2H2 Zn finger 295..315 CDD:275368 5/19 (26%)
C2H2 Zn finger 323..343 CDD:275368 8/19 (42%)
C2H2 Zn finger 351..371 CDD:275368 5/19 (26%)
C2H2 Zn finger 379..399 CDD:275368 8/22 (36%)
C2H2 Zn finger 407..427 CDD:275368 7/21 (33%)
C2H2 Zn finger 435..455 CDD:275368
C2H2 Zn finger 463..483 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24399
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.