DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10321 and ZBTB49

DIOPT Version :9

Sequence 1:NP_001261124.1 Gene:CG10321 / 37464 FlyBaseID:FBgn0034643 Length:855 Species:Drosophila melanogaster
Sequence 2:NP_001317554.1 Gene:ZBTB49 / 166793 HGNCID:19883 Length:765 Species:Homo sapiens


Alignment Length:438 Identity:100/438 - (22%)
Similarity:159/438 - (36%) Gaps:116/438 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   459 EEQDPHLSGDVD-----DDLEYSIMEPPDGE-TSVDIDQA--FMDSEQSHHQQHQEEMQSISLEN 515
            :|..||.|..|:     .::.....:..||. |.:...|.  :......:.:|:.:.....|.|.
Human   171 DESHPHASPSVNRHHSAGEISKQAPDTSDGSCTELPFKQPNYYYKLRNFYSKQYHKHAAGPSQER 235

  Fly   516 AVVE---FSQAT--TTTEA-----------LVGP--------TMTVSSASPTPK----------- 545
            .|.:   ||.:|  ||.|:           |..|        ...|:.::|.|:           
Human   236 VVEQPFAFSTSTDLTTVESQPCAVSHSECILESPEHLPSNFLAQPVNDSAPHPESDATCQQPVKQ 300

  Fly   546 -RAKRSNH---------QIPAGVTLEP-----CDHQPPAAGSTTSSKLAAANSRQLVQTASVIAA 595
             |.|::.|         |..|....||     ...:..:|...|..| |::.|.:..::..|::.
Human   301 MRLKKAIHLKKLNFLKSQKYAEQVSEPKSDDGLTKRLESASKNTLEK-ASSQSAEEKESEEVVSC 364

  Fly   596 AGADDNYEIDANLVTE--------FIRQHTSPLGSGR-YICHLCSTEFRQFKGLQNHMHSHTNWI 651
                :|:    |.::|        .:...:..|.|.| |.|.||...|:....|:.|..|||.  
Human   365 ----ENF----NCISETERPEDPAALEDQSQTLQSQRQYACELCGKPFKHPSNLELHKRSHTG-- 419

  Fly   652 RANCKKQPQCQICLKSFKGPGMLRMHMKTHDAESSTPMCTICNRTFKSKAILYRHRQTHQ-QRAY 715
                :|..:|.||.|.|...|.|:.|::.|..|... :|.||.:.|.:...:.||...|. ::.:
Human   420 ----EKPFECNICGKHFSQAGNLQTHLRRHSGEKPY-ICEICGKRFAASGDVQRHIIIHSGEKPH 479

  Fly   716 CCGVANCRKNFSSAVNLKWHVERKHPEVVDPLFKCGECGSLYDNVDSLQLHVESTDHSAEVQISG 780
            .|.:  |.:.||:..|||   |.|.....|.:|.|.|||..::....|..|  ...|:.|...| 
Human   480 LCDI--CGRGFSNFSNLK---EHKKTHTADKVFTCDECGKSFNMQRKLVKH--RIRHTGERPYS- 536

  Fly   781 QDDAFSGAVSIVSNGTTDMSNMMATGQGTTLAGGTGDTHAVVMGSSGE 828
                                 ..|.|:   ..||:||....|...:||
Human   537 ---------------------CSACGK---CFGGSGDLRRHVRTHTGE 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10321NP_001261124.1 zf-AD 12..80 CDD:214871
ASF1_hist_chap <405..516 CDD:304562 12/64 (19%)
C2H2 Zn finger 627..647 CDD:275368 6/19 (32%)
C2H2 Zn finger 661..681 CDD:275368 8/19 (42%)
C2H2 Zn finger 690..710 CDD:275368 6/19 (32%)
C2H2 Zn finger 717..740 CDD:275368 8/22 (36%)
C2H2 Zn finger 750..767 CDD:275368 5/16 (31%)
ZBTB49NP_001317554.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..203 7/31 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 275..294 3/18 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24399
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.