DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10321 and ZNF572

DIOPT Version :9

Sequence 1:NP_001261124.1 Gene:CG10321 / 37464 FlyBaseID:FBgn0034643 Length:855 Species:Drosophila melanogaster
Sequence 2:NP_689625.2 Gene:ZNF572 / 137209 HGNCID:26758 Length:529 Species:Homo sapiens


Alignment Length:465 Identity:103/465 - (22%)
Similarity:152/465 - (32%) Gaps:158/465 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   346 LEDVYEQLDSKADHSFETIVLDDDQQQDFLKDHHEHHQVMINEDLTQSESQDHEYFDDLDQQQAM 410
            ||.|:.. :||||...|       :..::.|.|...|             ..||...::......
Human    34 LETVHHN-NSKADKLKE-------KPSEWSKRHRPQH-------------YKHEDAKEMPLTWVQ 77

  Fly   411 DEI--EDEEEQMKPEEDQDTFIIEEIQLEDDEMLDDPDGEEIDQDCEYIGEEQDPHLSGDVDDDL 473
            |||  .|..|.....|:...||.:|        .:.|:.:|.|.     ||    |.:..|..:.
Human    78 DEIWCHDSYESDGKSENWGNFIAKE--------EEKPNHQEWDS-----GE----HTNACVQQNS 125

  Fly   474 EYSIMEPPDGETSVDIDQAFMDSE-------QSHHQQHQEEMQSISLENAVVEFSQATTTTEALV 531
            .:             :|:.:..||       .||.:.||.                         
Human   126 SF-------------VDRPYKCSECWKSFSNSSHLRTHQR------------------------- 152

  Fly   532 GPTMTVSSASP--TPKRAK---RSNHQIPAGVTLEPCDH-------QPPAAGSTTSSKLAAANSR 584
                |.|...|  ..:.||   .|:|.|         .|       :|...|....|   .:|:.
Human   153 ----THSGEKPYKCSECAKCFCNSSHLI---------QHLRMHTGEKPYQCGECGKS---FSNTS 201

  Fly   585 QLVQTASVIAAAGADDNYEIDANLVTEFIRQHTSPLGSGRYICHLCSTEFRQFKGLQNHMHSHTN 649
            .|:                     :.|  |.||   |...|.|..|...|.....|..|..|||.
Human   202 HLI---------------------IHE--RTHT---GEKPYKCPECGKRFSSSSHLIQHHRSHTG 240

  Fly   650 WIRANCKKQPQCQICLKSFKGPGMLRMHMKTHDAESSTPMCTICNRTFKSKAILYRHRQTHQ-QR 713
                  :|..:|.:|.|.|....:|..|.:||..|... .|..|.::|...:.|.||::||. ::
Human   241 ------EKPYECSVCGKGFSHSYVLIEHQRTHTGEKPY-KCPDCGKSFSQSSSLIRHQRTHTGEK 298

  Fly   714 AYCCGVANCRKNFSSAVNLKWHVERKHPEVVDPLFKCGECGSLYDNVDSLQLHV-----ESTDHS 773
            .|.|  ..|.|:|.....|..| :|.|  ..:..::|.|||..:....:|..|.     |.:..|
Human   299 PYKC--LECEKSFGCNSTLIKH-QRIH--TGEKPYQCPECGKNFSRSSNLITHQKMHTGEKSYES 358

  Fly   774 AEVQIS-GQD 782
            :|.:.| ||:
Human   359 SEYEESLGQN 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10321NP_001261124.1 zf-AD 12..80 CDD:214871
ASF1_hist_chap <405..516 CDD:304562 23/119 (19%)
C2H2 Zn finger 627..647 CDD:275368 5/19 (26%)
C2H2 Zn finger 661..681 CDD:275368 6/19 (32%)
C2H2 Zn finger 690..710 CDD:275368 6/19 (32%)
C2H2 Zn finger 717..740 CDD:275368 7/22 (32%)
C2H2 Zn finger 750..767 CDD:275368 5/16 (31%)
ZNF572NP_689625.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62 10/35 (29%)
COG5048 122..494 CDD:227381 74/339 (22%)
C2H2 Zn finger 134..154 CDD:275368 6/48 (13%)
C2H2 Zn finger 162..182 CDD:275368 6/28 (21%)
C2H2 Zn finger 190..210 CDD:275368 6/45 (13%)
C2H2 Zn finger 218..238 CDD:275368 5/19 (26%)
C2H2 Zn finger 246..266 CDD:275368 6/19 (32%)
C2H2 Zn finger 274..294 CDD:275368 6/19 (32%)
C2H2 Zn finger 302..322 CDD:275368 7/22 (32%)
C2H2 Zn finger 330..350 CDD:275368 6/19 (32%)
C2H2 Zn finger 386..406 CDD:275368
C2H2 Zn finger 414..434 CDD:275368
C2H2 Zn finger 442..462 CDD:275368
C2H2 Zn finger 470..490 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24399
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.