DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10321 and OSR2

DIOPT Version :9

Sequence 1:NP_001261124.1 Gene:CG10321 / 37464 FlyBaseID:FBgn0034643 Length:855 Species:Drosophila melanogaster
Sequence 2:NP_001273770.1 Gene:OSR2 / 116039 HGNCID:15830 Length:433 Species:Homo sapiens


Alignment Length:151 Identity:41/151 - (27%)
Similarity:64/151 - (42%) Gaps:17/151 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   625 YICHLCSTEFRQFKGLQNHMHSHTNWIRANCKKQPQCQICLKSFKGPGMLRMHMKTHDAESSTPM 689
            :||..|...|.:...|..|..:||:      ::...|.||.|:|:....||.|...|..|.  |.
Human   293 FICKFCGRHFTKSYNLLIHERTHTD------ERPYTCDICHKAFRRQDHLRDHRYIHSKEK--PF 349

  Fly   690 -CTICNRTFKSKAILYRHRQTHQQRA-YCCGVANCRKNFSSAVNLKWHVERKHPEVVDPLFKCGE 752
             |..|.:.|.....|..|:..|.|.: :.|  ..|.:.|:...|||.|: ..|.::..  :.|.:
Human   350 KCQECGKGFCQSRTLAVHKTLHMQESPHKC--PTCGRTFNQRSNLKTHL-LTHTDIKP--YSCEQ 409

  Fly   753 CGSLYDNVDSLQLHVESTDHS 773
            ||.::.....|:.|  |..|:
Human   410 CGKVFRRNCDLRRH--SLTHT 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10321NP_001261124.1 zf-AD 12..80 CDD:214871
ASF1_hist_chap <405..516 CDD:304562
C2H2 Zn finger 627..647 CDD:275368 5/19 (26%)
C2H2 Zn finger 661..681 CDD:275368 8/19 (42%)
C2H2 Zn finger 690..710 CDD:275368 5/19 (26%)
C2H2 Zn finger 717..740 CDD:275368 7/22 (32%)
C2H2 Zn finger 750..767 CDD:275368 4/16 (25%)
OSR2NP_001273770.1 COG5048 <293..428 CDD:227381 40/149 (27%)
C2H2 Zn finger 295..315 CDD:275368 5/19 (26%)
zf-H2C2_2 307..332 CDD:290200 9/30 (30%)
C2H2 Zn finger 323..343 CDD:275368 8/19 (42%)
zf-H2C2_2 335..358 CDD:290200 8/24 (33%)
C2H2 Zn finger 351..371 CDD:275368 5/19 (26%)
zf-C2H2 377..399 CDD:278523 7/24 (29%)
C2H2 Zn finger 379..399 CDD:275368 7/22 (32%)
zf-H2C2_2 391..416 CDD:290200 8/27 (30%)
C2H2 Zn finger 407..427 CDD:275368 6/21 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.