Sequence 1: | NP_001261124.1 | Gene: | CG10321 / 37464 | FlyBaseID: | FBgn0034643 | Length: | 855 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_001922816.3 | Gene: | bif1.1 / 103908654 | ZFINID: | ZDB-GENE-081031-77 | Length: | 346 | Species: | Danio rerio |
Alignment Length: | 257 | Identity: | 67/257 - (26%) |
---|---|---|---|
Similarity: | 94/257 - (36%) | Gaps: | 53/257 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 543 TPKRA--------KRSNHQIPAGVTLEPCD-------HQPPAAGSTTSSKLAAAN-----SRQLV 587
Fly 588 QTASV----------IAAAGAD--DNYEIDANLVTEFIRQHTSPLGSGRYICHLCSTEFRQFKGL 640
Fly 641 QNHMHSHTNWIRANCKKQPQCQICLKSFKGPGMLRMHMKTHDAESSTPMCTICNRTFKSKAILYR 705
Fly 706 HRQTHQ-QRAYCCGVANCRKNFSSAVNLKWHVERKHPEVVDPLFKCGECGSLYDNVDSLQLH 766 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10321 | NP_001261124.1 | zf-AD | 12..80 | CDD:214871 | |
ASF1_hist_chap | <405..516 | CDD:304562 | |||
C2H2 Zn finger | 627..647 | CDD:275368 | 5/19 (26%) | ||
C2H2 Zn finger | 661..681 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 690..710 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 717..740 | CDD:275368 | 7/22 (32%) | ||
C2H2 Zn finger | 750..767 | CDD:275368 | 6/17 (35%) | ||
bif1.1 | XP_001922816.3 | COG5048 | <63..251 | CDD:227381 | 53/207 (26%) |
C2H2 Zn finger | 67..87 | CDD:275368 | 3/19 (16%) | ||
C2H2 Zn finger | 95..115 | CDD:275368 | 5/24 (21%) | ||
C2H2 Zn finger | 123..143 | CDD:275368 | 5/19 (26%) | ||
zf-H2C2_2 | 135..158 | CDD:290200 | 8/28 (29%) | ||
C2H2 Zn finger | 151..171 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 180..200 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 208..227 | CDD:275368 | 7/22 (32%) | ||
C2H2 Zn finger | 238..255 | CDD:275368 | 5/14 (36%) | ||
C2H2 Zn finger | 263..283 | CDD:275368 | |||
C2H2 Zn finger | 291..311 | CDD:275368 | |||
C2H2 Zn finger | 319..337 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24399 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |