DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10321 and bcl6

DIOPT Version :9

Sequence 1:NP_001261124.1 Gene:CG10321 / 37464 FlyBaseID:FBgn0034643 Length:855 Species:Drosophila melanogaster
Sequence 2:NP_001116278.1 Gene:bcl6 / 100126063 XenbaseID:XB-GENE-984479 Length:702 Species:Xenopus tropicalis


Alignment Length:510 Identity:107/510 - (20%)
Similarity:171/510 - (33%) Gaps:136/510 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 EDGCEVEDEELEDVYEQLDSKADHSFETIVLDDDQQQDFLKDHHEHHQVMINEDLTQSESQDHEY 400
            ||  ||:|.::.::     .||..:.:..||..:..:..|.|   :.:||.:.......|.::..
 Frog   207 ED--EVKDMQMSEM-----QKASRNQKERVLPGENSRTLLGD---YRKVMSDMSFNMCHSNNYSQ 261

  Fly   401 FDDLDQQQAMDEIEDE--------EEQMKPEEDQDTFIIEEIQLEDDEMLDDPDGEEIDQDCEYI 457
            .|     .||:|...|        .....|......|...|...:::|.....|  ||.|     
 Frog   262 KD-----VAMEEPRSEAHYNMVIGSRSAGPSFRSSPFFTCEKTTKEEERTSSED--EISQ----- 314

  Fly   458 GEEQDPHLSGDVDDDLEYSIMEPPDGETSVDIDQAFMDSEQSHHQQHQEEMQSISLENAVVEFSQ 522
                  |............::.|              .|.|....|.....:|.|.:||.:....
 Frog   315 ------HFKPTNSPANRKGLVSP--------------QSPQKSDCQPNSPTESSSSKNARISQGS 359

  Fly   523 ATTTTEALVGPT-------MTVSSASPTPKRA----------------KRSNHQIPAGVTLEPCD 564
            ::..::....|.       |.:||.....|.:                ..|::|.|  |..|..|
 Frog   360 SSPVSKNSTDPKACNWKKYMMLSSLKQRDKESCTKQSEIDNLSPNSYTSLSSYQHP--VKSENAD 422

  Fly   565 HQ--PPAAGST------TSSKLAAANSRQLVQTASVIAAAGADDNYEIDANLVTEFIRQ------ 615
            .|  |...|||      .:|||....:|.|  ..|..::.|....| :.|:....|..|      
 Frog   423 DQASPKINGSTEDPLIPQASKLNNLVNRSL--EGSPQSSEGHSPLY-VHASKFNLFSSQSPPELC 484

  Fly   616 -HT------------------SPLGSGRYICHLCSTEFRQFKGLQNHMHSHTNWIRANCKKQPQC 661
             ||                  |...:|.:.|:.|.:.|.:...|:.||      ::.:..|..:|
 Frog   485 PHTPGSNFGEEITETQSEYSDSSCENGTFFCNECDSRFSEEGSLKRHM------LQVHSDKPYKC 543

  Fly   662 QICLKSFKGPGMLRMHMKTHDAESSTPMCTICNRTFKSKAILYRHRQTHQ-QRAYCCGVANCRKN 725
            ..|..||:..|.|..|...|..|... .|:||...|...|.|..|.:.|. ::.|.|  ..|...
 Frog   544 DRCQASFRYKGNLASHKTVHTGEKPY-RCSICGAQFNRPANLKTHTRIHSGEKPYKC--ETCGAR 605

  Fly   726 FSSAVNLKWHV-----ERKHPEVVDPLFKCGECGSLYDNVDSLQLHVESTDHSAE 775
            |....:|:.||     |:.:|        |..||:.:.::.:|:.|:..  |:.|
 Frog   606 FVQVAHLRAHVLIHTGEKPYP--------CEICGTRFRHLQTLKSHLRI--HTGE 650

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10321NP_001261124.1 zf-AD 12..80 CDD:214871
ASF1_hist_chap <405..516 CDD:304562 19/118 (16%)
C2H2 Zn finger 627..647 CDD:275368 6/19 (32%)
C2H2 Zn finger 661..681 CDD:275368 7/19 (37%)
C2H2 Zn finger 690..710 CDD:275368 7/19 (37%)
C2H2 Zn finger 717..740 CDD:275368 7/27 (26%)
C2H2 Zn finger 750..767 CDD:275368 4/16 (25%)
bcl6NP_001116278.1 BTB 24..128 CDD:279045
BTB 35..131 CDD:197585
C2H2 Zn finger 515..536 CDD:275368 6/26 (23%)
C2H2 Zn finger 543..563 CDD:275368 7/19 (37%)
zf-H2C2_2 555..580 CDD:290200 8/25 (32%)
C2H2 Zn finger 571..591 CDD:275368 7/19 (37%)
zf-H2C2_2 583..608 CDD:290200 7/26 (27%)
C2H2 Zn finger 599..619 CDD:275368 6/21 (29%)
zf-H2C2_2 611..636 CDD:290200 8/32 (25%)
C2H2 Zn finger 627..647 CDD:275368 5/21 (24%)
zf-H2C2_2 640..664 CDD:290200 4/13 (31%)
C2H2 Zn finger 655..673 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24399
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.