DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTP-ER and PTPN5

DIOPT Version :9

Sequence 1:NP_726092.1 Gene:PTP-ER / 37461 FlyBaseID:FBgn0016641 Length:1377 Species:Drosophila melanogaster
Sequence 2:XP_016873923.1 Gene:PTPN5 / 84867 HGNCID:9657 Length:719 Species:Homo sapiens


Alignment Length:429 Identity:111/429 - (25%)
Similarity:151/429 - (35%) Gaps:168/429 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   843 GSNARDVETPTDMVPPS----------SEDSELLASYQTVVSRMAQPIPELKENEQKRIFRDLHK 897
            |||   |....||..|.          |...|....|....||:.| ..||.|.......  |..
Human   244 GSN---VSLTLDMCTPGCNEEGFGYLMSPREESAREYLLSASRVLQ-AEELHEKALDPFL--LQA 302

  Fly   898 EFWDLPLNHQEKPMVF---GSQTKNRYKTILPNENSRVLLESESSE--LTSLLGEIKRTSSVTAS 957
            ||:::|:|..: |..:   |...||||||||||.:|||.|.|...:  |:|              
Human   303 EFFEIPMNFVD-PKEYDIPGLVRKNRYKTILPNPHSRVCLTSPDPDDPLSS-------------- 352

  Fly   958 EDLPYINANYIKGPDYVSKCYVATQGPLPNTIFEFWLMIYQNTQRYIRRCVDGGSSSSPHVDREQ 1022
                |||||||:|.....|.|:|||||:.:|:.:||.|::                         
Human   353 ----YINANYIRGYGGEEKVYIATQGPIVSTVADFWRMVW------------------------- 388

  Fly  1023 ILQQYFQKIVMLTNFTEANRQKCAVYFP--------IELN----------EIFAVAAKCEVFQLS 1069
              |::...|||:||..|.| :||..|:|        :|:.          .:..::.||      
Human   389 --QEHTPIIVMITNIEEMN-EKCTEYWPEEQVAYDGVEITVQKVIHTEDYRLRLISLKC------ 444

  Fly  1070 AAARDYFDR------YLTPTFV--------PDTVVASSDAIDYEISGRH---------------- 1104
               ||:.||      :|.|...        .|.|.|.|.      .|||                
Human   445 ---RDWEDRLLHCHQHLLPAAAAGGCGGHPEDHVPAPSG------QGRHDPDMRAVPVCAPRHEP 500

  Fly  1105 ---IGVESV----KVTLEGDLLEALPAQ--GSFFLIKNVGIVRRNGYSVRKLVLLYCIRVPQSAS 1160
               ..|..|    .:.|:|.|..|.|..  ....|.:.:|::..:..||..|    |   |.|| 
Human   501 LRKAAVPPVPRMTALLLQGSLGTAQPESRPSPRALPRVLGLLPASSPSVSSL----C---PLSA- 557

  Fly  1161 YHLQKIYCYHYWYPDWPDHHSPRDINTLLDTCLHVLNLG 1199
                           |||.:.|     .|...|::|..|
Human   558 ---------------WPDPYPP-----ALLFLLYILGSG 576

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTP-ERNP_726092.1 Y_phosphatase 916..1364 CDD:278528 88/343 (26%)
PTPc 917..1364 CDD:238006 88/342 (26%)
PTPN5XP_016873923.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 220 1.000 Inparanoid score I3565
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.