DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTP-ER and PTPN12

DIOPT Version :9

Sequence 1:NP_726092.1 Gene:PTP-ER / 37461 FlyBaseID:FBgn0016641 Length:1377 Species:Drosophila melanogaster
Sequence 2:NP_002826.3 Gene:PTPN12 / 5782 HGNCID:9645 Length:780 Species:Homo sapiens


Alignment Length:527 Identity:124/527 - (23%)
Similarity:177/527 - (33%) Gaps:241/527 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   861 EDSELLASYQTVVSRMAQPIPELKENEQKRIFRD------LHKEFWDLPLNHQEK--PMVFGSQ- 916
            |..|:|..:...|..|..|    ..|.:....||      |..::      ..||  |...|.: 
Human     2 EQVEILRKFIQRVQAMKSP----DHNGEDNFARDFMRLRRLSTKY------RTEKIYPTATGEKE 56

  Fly   917 ---TKNRYKTILPNENSRVLLESESSELTSLLGEIKRTSSVTASEDLPYINANYIKGPDYVSKCY 978
               .|||||.|||.::|||.|..:                 |.|:|..|||||:|||. |..|.|
Human    57 ENVKKNRYKDILPFDHSRVKLTLK-----------------TPSQDSDYINANFIKGV-YGPKAY 103

  Fly   979 VATQGPLPNTIFEFWLMIYQNTQRYIRRCVDGGSSSSPHVDREQILQQYFQKIVMLTNFTEANRQ 1043
            |||||||.||:.:||.||::..                           ...|||.....|..|:
Human   104 VATQGPLANTVIDFWRMIWEYN---------------------------VVIIVMACREFEMGRK 141

  Fly  1044 KCAVYFPIELNEIFAVAAKCEVFQLSAAARDYFDRYLTPTFVPDTVVASSDAIDYEISGRHIGVE 1108
            ||..|:|:                       |.:..:  ||.|                      
Human   142 KCERYWPL-----------------------YGEDPI--TFAP---------------------- 159

  Fly  1109 SVKVTLEGDLLEALPAQGSFFLIKNVGIVRRNGYSVRKLVLLYCIRVPQSASYHLQKIYCYHYWY 1173
             .|::.|.:                   ..|..|.:|.|:|.:     |:.|   :::|.:|  |
Human   160 -FKISCEDE-------------------QARTDYFIRTLLLEF-----QNES---RRLYQFH--Y 194

  Fly  1174 PDWPDHHSPRDINTLLDTCLHVLNLGKCESEFDIYDDTRSERNAHLAAQRLEIYQQDIFNAVQPL 1238
            .:||||..|...:::||    :::|                         :..||:.     :.:
Human   195 VNWPDHDVPSSFDSILD----MISL-------------------------MRKYQEH-----EDV 225

  Fly  1239 PV-IHCSAGIGRTGCFTAILNAVRQLRQSLAYSLTGMLTKSLTSSSTEEYHNPTDSDSSFTCNTI 1302
            |: ||||||.||||...||                                       .:|.|.:
Human   226 PICIHCSAGCGRTGAICAI---------------------------------------DYTWNLL 251

  Fly  1303 RHISHILDHRDAEAVKTPPSFDRLPKMPDIFVDVLGIVCNLRLQRGGMVQNSEQYELIHRAICLY 1367
            :            |.|.|..|           :|..::..:|.||...||..|||||:||||...
Human   252 K------------AGKIPEEF-----------NVFNLIQEMRTQRHSAVQTKEQYELVHRAIAQL 293

  Fly  1368 LKRTLAL 1374
            .::.|.|
Human   294 FEKQLQL 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTP-ERNP_726092.1 Y_phosphatase 916..1364 CDD:278528 106/452 (23%)
PTPc 917..1364 CDD:238006 106/447 (24%)
PTPN12NP_002826.3 PTPc 28..292 CDD:214550 115/487 (24%)
PTPc 60..292 CDD:238006 108/449 (24%)
Substrate binding. /evidence=ECO:0000305|PubMed:27134172 63..67 3/3 (100%)
Substrate binding. /evidence=ECO:0000250 231..237 4/5 (80%)
Interaction with TGFB1I1. /evidence=ECO:0000250 345..438
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 502..639
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 657..725
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 744..780
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.