DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTP-ER and PTPN1

DIOPT Version :9

Sequence 1:NP_726092.1 Gene:PTP-ER / 37461 FlyBaseID:FBgn0016641 Length:1377 Species:Drosophila melanogaster
Sequence 2:NP_002818.1 Gene:PTPN1 / 5770 HGNCID:9642 Length:435 Species:Homo sapiens


Alignment Length:492 Identity:92/492 - (18%)
Similarity:152/492 - (30%) Gaps:233/492 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly   884 KENEQ-------KRIFRDLHKEFWDLPLNHQEKPMVFGSQTKNRYKTILPNENSRVLLESESSEL 941
            ||.||       ..|::|:..|..|.|....:.|.   ::.:|||:.:.|.::||:.|..|.:: 
Human     5 KEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPK---NKNRNRYRDVSPFDHSRIKLHQEDND- 65

  Fly   942 TSLLGEIKRTSSVTASEDLPYINANYIKGPDYVSKCYVATQGPLPNTIFEFWLMIYQNTQRYIRR 1006
                                ||||:.|| .:...:.|:.||||||||...||.|:::...|    
Human    66 --------------------YINASLIK-MEEAQRSYILTQGPLPNTCGHFWEMVWEQKSR---- 105

  Fly  1007 CVDGGSSSSPHVDREQILQQYFQKIVMLTNFTEANRQKCAVYFPIELNEIFAVAAKCEVFQLSAA 1071
                                   .:|||....|....|||.|:|.:       ..|..:|:    
Human   106 -----------------------GVVMLNRVMEKGSLKCAQYWPQK-------EEKEMIFE---- 136

  Fly  1072 ARDYFDRYLTPTFVPDTVVASSDAIDYEISGRHIGVESVKVTLEGDLLEALPAQGSFFLIKNVGI 1136
                           ||                    ::|:||..:.::      |::.::.:.:
Human   137 ---------------DT--------------------NLKLTLISEDIK------SYYTVRQLEL 160

  Fly  1137 VRRNGYSVRKLVLLYCIRVPQSASYHLQKIYCYHYWYPDWPDHHSPRDINTLLDTCLHVLNLGKC 1201
            ........|:::                     |:.|..|||...|....:.|:....|...|..
Human   161 ENLTTQETREIL---------------------HFHYTTWPDFGVPESPASFLNFLFKVRESGSL 204

  Fly  1202 ESEFDIYDDTRSERNAHLAAQRLEIYQQDIFNAVQPLPVIHCSAGIGRTGCF----TAILNAVRQ 1262
            ..|..                              |: |:||||||||:|.|    |.:|     
Human   205 SPEHG------------------------------PV-VVHCSAGIGRSGTFCLADTCLL----- 233

  Fly  1263 LRQSLAYSLTGMLTKSLTSSSTEEYHNPTDSDSSFTCNTIRHISHILDHRDAEAVKTPPSFDRLP 1327
                                                         ::|.|     |.|.|     
Human   234 ---------------------------------------------LMDKR-----KDPSS----- 243

  Fly  1328 KMPDIFVDVLGIVCNLRLQRGGMVQNSEQYELIHRAI 1364
                  ||:..::..:|..|.|::|.::|....:.|:
Human   244 ------VDIKKVLLEMRKFRMGLIQTADQLRFSYLAV 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTP-ERNP_726092.1 Y_phosphatase 916..1364 CDD:278528 81/451 (18%)
PTPc 917..1364 CDD:238006 81/450 (18%)
PTPN1NP_002818.1 PTPc 3..276 CDD:214550 92/492 (19%)
Substrate binding. /evidence=ECO:0000250 215..221 5/5 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 338..359
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 378..398
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.