DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTP-ER and B0280.17

DIOPT Version :9

Sequence 1:NP_726092.1 Gene:PTP-ER / 37461 FlyBaseID:FBgn0016641 Length:1377 Species:Drosophila melanogaster
Sequence 2:NP_001040836.2 Gene:B0280.17 / 4363051 WormBaseID:WBGene00044674 Length:260 Species:Caenorhabditis elegans


Alignment Length:197 Identity:41/197 - (20%)
Similarity:71/197 - (36%) Gaps:63/197 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 TPRPTHAAPSDTTPLEAGEDAESN--------KSTP-YFTPLEYLQTSFEFPSPTVEVGGGVP-G 75
            ||.|:....::     ||:|...:        |..| ..||...||....|...|:.:.||:. |
 Worm    66 TPPPSFLGRAN-----AGKDESMDLSSLRNLLKDDPLLMTPPPGLQRRQTFSPMTLSLIGGLKNG 125

  Fly    76 FPEHEDQEE-------EVFTPRQFTITSPHPAAHVHHPSSSQSPTLGRKFKRLSQYDR------- 126
            ..|:|::||       :||.|.: |..:.:|...:          :|.:...:.|.::       
 Worm   126 CSENENKEEGKFEKIDKVFFPPE-TANNTNPVGRL----------IGPRGMTIRQLEKDLGCKLF 179

  Fly   127 ---RSCSPHINTSSGEER-----------------VSGRGIDKENTMPKGGSVDQDLENSLYLSK 171
               :.|:   ...:.|||                 :|.|...:|....|..|:.:.|:..|..:.
 Worm   180 IRGKGCT---KDDAKEERLRERVGWEHLKEPIHVMISVRSDSEEAASEKLSSIKKMLQEFLEHTD 241

  Fly   172 SE 173
            ||
 Worm   242 SE 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTP-ERNP_726092.1 Y_phosphatase 916..1364 CDD:278528
PTPc 917..1364 CDD:238006
B0280.17NP_001040836.2 KH-I 141..260 CDD:381803 20/117 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.