DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTP-ER and ptpn1

DIOPT Version :9

Sequence 1:NP_726092.1 Gene:PTP-ER / 37461 FlyBaseID:FBgn0016641 Length:1377 Species:Drosophila melanogaster
Sequence 2:NP_001300614.1 Gene:ptpn1 / 30081 ZFINID:ZDB-GENE-980605-23 Length:433 Species:Danio rerio


Alignment Length:366 Identity:71/366 - (19%)
Similarity:121/366 - (33%) Gaps:156/366 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   891 IFRDLHKEFWDLPLNHQEKPMVFGSQTKNRYKTILPNENSRVLLESESSELTSLLGEIKRTSSVT 955
            :::::.::..|||....:.|   .::::|||:.:.|.::||:.|:...::               
Zfish    17 VYQEIRQQSSDLPCKIAKLP---ENRSRNRYRDVSPFDHSRICLQIGCND--------------- 63

  Fly   956 ASEDLPYINANYIKGPDYVSKCYVATQGPLPNTIFEFWLMIYQNTQRYIRRCVDGGSSSSPHVDR 1020
                  ||||:.|...:...| |:.||||||||...||.|:::...|                  
Zfish    64 ------YINASLISVEEAQRK-YILTQGPLPNTCGHFWEMVWEQRSR------------------ 103

  Fly  1021 EQILQQYFQKIVMLTNFTEANRQKCAVYFPIELNEIFAVAAKCEVFQLSAAARDYFDRYLTPTFV 1085
                     .:|||....|....|||.|:| :..|..||..... |:|:..:.|           
Zfish   104 ---------GVVMLNRVIEKGSVKCAQYWP-QREEREAVFEDTN-FRLTLISED----------- 146

  Fly  1086 PDTVVASSDAIDYEISGRHIGVESVKVTLEGDLLEALPAQGSFFLIKNVGIVRRNGYSVRKLVLL 1150
                                    ||               |::.::.:.:...:....|:::  
Zfish   147 ------------------------VK---------------SYYTVRQLELENLSTQETREIL-- 170

  Fly  1151 YCIRVPQSASYHLQKIYCYHYWYPDWPDHHSPRDINTLLDTCLHVLNLGKCESEFDIYDDTRSER 1215
                               |:.|..|||...|....:.|:....|...|....|           
Zfish   171 -------------------HFHYTTWPDFGVPESPASFLNFLFKVRESGCLSPE----------- 205

  Fly  1216 NAHLAAQRLEIYQQDIFNAVQPLPVIHCSAGIGRTGCFTAI 1256
                               :.|: |:||||||||:|.|..:
Zfish   206 -------------------LGPV-VVHCSAGIGRSGTFCLV 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTP-ERNP_726092.1 Y_phosphatase 916..1364 CDD:278528 67/341 (20%)
PTPc 917..1364 CDD:238006 67/340 (20%)
ptpn1NP_001300614.1 PTPc 1..274 CDD:214550 71/366 (19%)
PTPc 41..274 CDD:238006 67/339 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.