DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTP-ER and Ptpn22

DIOPT Version :9

Sequence 1:NP_726092.1 Gene:PTP-ER / 37461 FlyBaseID:FBgn0016641 Length:1377 Species:Drosophila melanogaster
Sequence 2:NP_001099930.1 Gene:Ptpn22 / 295338 RGDID:1307992 Length:804 Species:Rattus norvegicus


Alignment Length:502 Identity:110/502 - (21%)
Similarity:161/502 - (32%) Gaps:234/502 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly   883 LKENEQKRIFR-DLHKEFWDL-------------PLNHQEKPMVFGSQTKNRYKTILPNENSRVL 933
            |||.::|:|.| :...||..|             |....::|.   :..|||||.|||.::|.|.
  Rat    11 LKEAQKKKINREEFANEFLKLKRQSTKYKADKIYPTTVAQRPK---NIKKNRYKDILPYDHSLVE 72

  Fly   934 LESESSELTSLLGEIKRTSSVTASEDLPYINANYIKGPDYVSKCYVATQGPLPNTIFEFWLMIYQ 998
            |                 |.:|:.||..||||::|||. |..:.|:||||||..|:.:||.||::
  Rat    73 L-----------------SLLTSDEDSSYINASFIKGV-YGPRAYIATQGPLSTTLLDFWRMIWE 119

  Fly   999 NTQRYIRRCVDGGSSSSPHVDREQILQQYFQKIVMLTNFTEANRQKCAVYFPIELNEIFAVAAKC 1063
                                  .::|     .|||.....|..::||..|:              
  Rat   120 ----------------------YRVL-----VIVMACMEFEMGKKKCERYW-------------- 143

  Fly  1064 EVFQLSAAARDYFDRYLTPTFVPDTVVASSDAIDYEISGRHIGVESVKVTLEGDLLEALPAQGSF 1128
                                       |.......:.....|..|:.|                 
  Rat   144 ---------------------------AEPGETQLQFGPFSISCETEK----------------- 164

  Fly  1129 FLIKNVGIVRRNGYSVRKLVLLYCIRVPQSASYHLQKIYCYHYWYPDWPDHHSPRDINTLLDTCL 1193
                     :::.|.:|.|          .|.::.:....|.:.|.:||||..|..|:.:|..  
  Rat   165 ---------KKSDYKIRTL----------KAKFNSETRIVYQFHYKNWPDHDVPSSIDPILQL-- 208

  Fly  1194 HVLNLGKCESEFDIYDDTRSERNAHLAAQRLEIYQQDIFNAVQPLPVIHCSAGIGRTGCFTAILN 1258
                         |:|              :..||:|  :.| || .||||||.||||...|:  
  Rat   209 -------------IWD--------------MRCYQED--DCV-PL-CIHCSAGCGRTGVICAV-- 240

  Fly  1259 AVRQLRQSLAYSLTGMLTKSLTSSSTEEYHNPTDSDSSFTCNTIRHISHILDHRDAEAVKTPPSF 1323
                       ..|.||.|.                                             
  Rat   241 -----------DYTWMLLKD--------------------------------------------- 249

  Fly  1324 DRLPKMPDIFVDVLGIVCNLRLQRGGMVQNSEQYELIHRAICLYLKR 1370
            ..:||...:|    .::..:|.||..:||..|||||::.|:....||
  Rat   250 GIIPKNFSVF----NLIQEMRTQRPSLVQTQEQYELVYSAVLELFKR 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTP-ERNP_726092.1 Y_phosphatase 916..1364 CDD:278528 96/447 (21%)
PTPc 917..1364 CDD:238006 96/446 (22%)
Ptpn22NP_001099930.1 PTPc 24..288 CDD:214550 102/483 (21%)
PTPc 56..288 CDD:238006 97/448 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.