DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTP-ER and Ptpn1

DIOPT Version :9

Sequence 1:NP_726092.1 Gene:PTP-ER / 37461 FlyBaseID:FBgn0016641 Length:1377 Species:Drosophila melanogaster
Sequence 2:XP_038960209.1 Gene:Ptpn1 / 24697 RGDID:61965 Length:451 Species:Rattus norvegicus


Alignment Length:479 Identity:96/479 - (20%)
Similarity:149/479 - (31%) Gaps:228/479 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly   891 IFRDLHKEFWDLPLNHQEKPMVFGSQTKNRYKTILPNENSRVLLESESSELTSLLGEIKRTSSVT 955
            ||.|:..|..|.|....:.|.   ::.:|||:.:.|.::||:.|..|.::               
  Rat    38 IFPDIRHEASDFPCRIAKLPK---NKNRNRYRDVSPFDHSRIKLHQEDND--------------- 84

  Fly   956 ASEDLPYINANYIKGPDYVSKCYVATQGPLPNTIFEFWLMIYQNTQRYIRRCVDGGSSSSPHVDR 1020
                  ||||:.|| .:...:.|:.||||||||...||.|:::...|                  
  Rat    85 ------YINASLIK-MEEAQRSYILTQGPLPNTCGHFWEMVWEQKSR------------------ 124

  Fly  1021 EQILQQYFQKIVMLTNFTEANRQKCAVYFP-IELNEIFAVAAKCEVFQLSAAARDYFDRYLTPTF 1084
                     .:|||....|....|||.|:| .|..|:                  .||       
  Rat   125 ---------GVVMLNRIMEKGSLKCAQYWPQKEEKEM------------------VFD------- 155

  Fly  1085 VPDTVVASSDAIDYEISGRHIGVESVKVTLEGDLLEALPAQGSFFLIKNVGIVRRNGYSVRKLVL 1149
              ||                    ::|:||..:.:::.                   |:||:|.|
  Rat   156 --DT--------------------NLKLTLISEDVKSY-------------------YTVRQLEL 179

  Fly  1150 LYCIRVPQSASYHLQKIYCYHYWYPDWPDHHSPRDINTLLDTCLHVLNLGKCESEFDIYDDTRSE 1214
                  ...|:...::|  .|:.|..|||...|....:.|:....|...|....|..        
  Rat   180 ------ENLATQEAREI--LHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHG-------- 228

  Fly  1215 RNAHLAAQRLEIYQQDIFNAVQPLPVIHCSAGIGRTGCF----TAILNAVRQLRQSLAYSLTGML 1275
                                  |: |:||||||||:|.|    |.:|                  
  Rat   229 ----------------------PI-VVHCSAGIGRSGTFCLADTCLL------------------ 252

  Fly  1276 TKSLTSSSTEEYHNPTDSDSSFTCNTIRHISHILDHRDAEAVKTPPSFDRLPKMPDIFVDVLGIV 1340
                                            ::|.|     |.|.|           ||:..::
  Rat   253 --------------------------------LMDKR-----KDPSS-----------VDIKKVL 269

  Fly  1341 CNLRLQRGGMVQNSEQYELIHRAI 1364
            ..:|..|.|::|.::|....:.|:
  Rat   270 LEMRRFRMGLIQTADQLRFSYLAV 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTP-ERNP_726092.1 Y_phosphatase 916..1364 CDD:278528 88/452 (19%)
PTPc 917..1364 CDD:238006 88/451 (20%)
Ptpn1XP_038960209.1 PTPc-N1 38..311 CDD:350456 96/479 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.