DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTP-ER and Ptpn12

DIOPT Version :9

Sequence 1:NP_726092.1 Gene:PTP-ER / 37461 FlyBaseID:FBgn0016641 Length:1377 Species:Drosophila melanogaster
Sequence 2:NP_001343519.1 Gene:Ptpn12 / 19248 MGIID:104673 Length:789 Species:Mus musculus


Alignment Length:458 Identity:110/458 - (24%)
Similarity:157/458 - (34%) Gaps:219/458 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly   918 KNRYKTILPNENSRVLLESESSELTSLLGEIKRTSSVTASEDLPYINANYIKGPDYVSKCYVATQ 982
            |||||.|||.::|||.|..:                 |.|:|..|||||:|||. |..|.|||||
Mouse    75 KNRYKDILPFDHSRVKLTLK-----------------TPSQDSDYINANFIKGV-YGPKAYVATQ 121

  Fly   983 GPLPNTIFEFWLMIYQNTQRYIRRCVDGGSSSSPHVDREQILQQYFQKIVMLTNFTEANRQKCAV 1047
            |||.||:.:||.||::..                           ...|||.....|..|:||..
Mouse   122 GPLANTVIDFWRMIWEYN---------------------------VVIIVMACREFEMGRKKCER 159

  Fly  1048 YFPIELNEIFAVAAKCEVFQLSAAARDYFDRYLTPTFVPDTVVASSDAIDYEISGRHIGVESVKV 1112
            |:|:                       |.:..:  ||.|                       .|:
Mouse   160 YWPL-----------------------YGEDPI--TFAP-----------------------FKI 176

  Fly  1113 TLEGDLLEALPAQGSFFLIKNVGIVRRNGYSVRKLVLLYCIRVPQSASYHLQKIYCYHYWYPDWP 1177
            :.|.:                   ..|..|.:|.|:|.:     |:.|   :::|.:|  |.:||
Mouse   177 SCENE-------------------QARTDYFIRTLLLEF-----QNES---RRLYQFH--YVNWP 212

  Fly  1178 DHHSPRDINTLLDTCLHVLNLGKCESEFDIYDDTRSERNAHLAAQRLEIYQQDIFNAVQPLPV-I 1241
            ||..|...:::||    :::|                         :..||:.     :.:|: |
Mouse   213 DHDVPSSFDSILD----MISL-------------------------MRKYQEH-----EDVPICI 243

  Fly  1242 HCSAGIGRTGCFTAILNAVRQLRQSLAYSLTGMLTKSLTSSSTEEYHNPTDSDSSFTCNTIRHIS 1306
            |||||.||||...||                                       .:|.|.::   
Mouse   244 HCSAGCGRTGAICAI---------------------------------------DYTWNLLK--- 266

  Fly  1307 HILDHRDAEAVKTPPSFDRLPKMPDIFVDVLGIVCNLRLQRGGMVQNSEQYELIHRAICLYLKRT 1371
                     |.|.|..|           :|..::..:|.||...||..|||||:||||....::.
Mouse   267 ---------AGKIPEEF-----------NVFNLIQEMRTQRHSAVQTKEQYELVHRAIAQLFEKQ 311

  Fly  1372 LAL 1374
            |.|
Mouse   312 LQL 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTP-ERNP_726092.1 Y_phosphatase 916..1364 CDD:278528 106/446 (24%)
PTPc 917..1364 CDD:238006 106/446 (24%)
Ptpn12NP_001343519.1 PTP_DSP_cys 43..312 CDD:391942 108/454 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.