DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTP-ER and Y116A8C.37

DIOPT Version :9

Sequence 1:NP_726092.1 Gene:PTP-ER / 37461 FlyBaseID:FBgn0016641 Length:1377 Species:Drosophila melanogaster
Sequence 2:NP_503038.1 Gene:Y116A8C.37 / 191006 WormBaseID:WBGene00013810 Length:298 Species:Caenorhabditis elegans


Alignment Length:320 Identity:68/320 - (21%)
Similarity:105/320 - (32%) Gaps:125/320 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   872 VVSR--MAQPIPEL---KENEQKRIFRDLHKEFWDLPLNHQEKPMVFGSQTKNRYKTILPNENSR 931
            ||.|  |..|:..|   |:.|:|...:::.||.|.     .|:|                   ::
 Worm    30 VVDRKEMDSPLGRLYEEKKEERKEEKKEVDKEPWS-----GEEP-------------------AK 70

  Fly   932 VLLESESSELTSLLGEIKRTSSV-TASEDLPYI--NANYIKGPDYVSKCYVATQGPLPNTIFEFW 993
            .::.:.....|::.|..|:|.:. |..:..|..  |.:.|:.||    |      |:|.      
 Worm    71 RMVANGFFTTTNVGGTFKQTDNFKTPMDSCPSFKNNMHKIRAPD----C------PIPE------ 119

  Fly   994 LMIYQNTQRYIRRCVDGGSSSSPHVDREQILQQYFQKIVMLTNFTEANRQKCAVYFPIELNEIFA 1058
                                               :|:|.|.|..|:                |.
 Worm   120 -----------------------------------EKLVKLANGPES----------------FI 133

  Fly  1059 VAAKCEVFQLSAAARDYFDRYLTPTFVPDTVVASSDAIDYEISGRHIGVESV------KVTLEGD 1117
            .|||..|        ..|:|.:..|.||| :..|.|..|:   .|.|..||:      .:.||..
 Worm   134 CAAKITV--------PDFNRTMILTQVPD-LSRSPDTADF---WRMIHQESIVSVVIAVMPLEVT 186

  Fly  1118 LLEALP-AQGSFFLIKNVGIVRRNGYSVRKLVLL--YCIRV-PQSASYH-LQKIYCYHYW 1172
            |.:.|| ..|::   ...|.:..|...|...|.:  ||:.: |...|.. |..:|..|.|
 Worm   187 LQQILPLLSGTY---STYGKMFVNNKKVESAVGMTEYCLEILPDGCSNSLLTTVYHMHNW 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTP-ERNP_726092.1 Y_phosphatase 916..1364 CDD:278528 54/271 (20%)
PTPc 917..1364 CDD:238006 54/270 (20%)
Y116A8C.37NP_503038.1 PTPc 87..283 CDD:214550 52/239 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.