DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTP-ER and hpo-7

DIOPT Version :9

Sequence 1:NP_726092.1 Gene:PTP-ER / 37461 FlyBaseID:FBgn0016641 Length:1377 Species:Drosophila melanogaster
Sequence 2:NP_494193.1 Gene:hpo-7 / 183354 WormBaseID:WBGene00016548 Length:285 Species:Caenorhabditis elegans


Alignment Length:214 Identity:44/214 - (20%)
Similarity:71/214 - (33%) Gaps:77/214 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly  1148 VLLYCIRVPQSASYHLQKIYCY-HYWYPDWPDHHSPRDINTLLDTCLHVLNLGKCESEFDIYDDT 1211
            |:|..|.:..:.|...::.:.. ||:|..|...:.|       :....:||              
 Worm    63 VVLRTIEITSNFSKSKKETHTIRHYFYKGWIAQNGP-------ELSREILN-------------- 106

  Fly  1212 RSERNAHLAAQRLEIYQQDIFNAVQPLP--VIHCSAGIGRTGCFTAILNAVRQLRQSLAYSLTGM 1274
                               :|.||:...  |:|||.||||...|..         ..|||. |.|
 Worm   107 -------------------VFKAVRKSKSVVVHCSTGIGRAAAFAF---------TELAYQ-TMM 142

  Fly  1275 LTKSLTSSSTEEYHNPTDSDSSFTCNTIRHISHILDHRD--AEAVKTPP--SFDRLPKMPDIFVD 1335
            |....|.:...:|                 :..|.|.|.  |.|:.||.  :|..:..:..:..:
 Worm   143 LNMRQTPTVGLDY-----------------VKLIQDLRSMRAGAIYTPMQLAFSIIMLLDFVLEN 190

  Fly  1336 VLGIVCNLRLQRGGMVQNS 1354
            .|....|::.|:   ::||
 Worm   191 ELSKETNIKYQQ---IRNS 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTP-ERNP_726092.1 Y_phosphatase 916..1364 CDD:278528 44/214 (21%)
PTPc 917..1364 CDD:238006 44/214 (21%)
hpo-7NP_494193.1 PTPc 1..178 CDD:304379 38/181 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.