DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTP-ER and K07F5.8

DIOPT Version :9

Sequence 1:NP_726092.1 Gene:PTP-ER / 37461 FlyBaseID:FBgn0016641 Length:1377 Species:Drosophila melanogaster
Sequence 2:NP_501766.1 Gene:K07F5.8 / 177833 WormBaseID:WBGene00010636 Length:284 Species:Caenorhabditis elegans


Alignment Length:453 Identity:86/453 - (18%)
Similarity:133/453 - (29%) Gaps:213/453 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly   918 KNRYKTILPNENSRVLLESESSELTSLLGEIKRTSSVTASEDLPYINANYIKGPDYVSKCYVATQ 982
            |||||.:...:|:||.|......                    .||:|||:..|.. .|.::.||
 Worm    21 KNRYKDVGCLDNNRVKLGGAWPH--------------------EYIHANYVSTPTN-PKRFICTQ 64

  Fly   983 GPLPNTIFEFWLMIYQNTQRYIRRCVDGGSSSSPHVDREQILQQYFQKIVMLTNFTEANRQKCAV 1047
            .||..|..:||.|           |                ||...:.|.||.|:.|...:||..
 Worm    65 APLEKTCADFWFM-----------C----------------LQDRVETIFMLCNYKEKGAKKCHE 102

  Fly  1048 YFPIELNEIFAVAAKCEVFQLSAAARDYFDRYLTPTFVPDTVVASSDAIDYEISGRHIGVESVKV 1112
            |.|.|.|:                                      |.:.::..|:       ||
 Worm   103 YLPTEDNK--------------------------------------DTMSFKEKGQ-------KV 122

  Fly  1113 TLEGDLLEALPAQGSFFLIKNVGIVRRNGYSVRKLVLLYCIRVPQSASYHLQKIYCYHYWYPDWP 1177
            |::.:..:|:..:.:            :...|.|.||     ..:.|.  ..|:...||.:.|||
 Worm   123 TVKFESSKAIKFRDN------------SAAKVTKTVL-----TVEGAG--CDKLKVNHYHWIDWP 168

  Fly  1178 DHHSPRDINTLLDTCLHVLNLGKCESEFDIYDDTRSERNAHLAAQRLEIYQQDIFNAVQPLPVIH 1242
            |...|...|.:|                ::.:..|..:.                    |: .:|
 Worm   169 DRGVPTADNAIL----------------ELLEKARVSKG--------------------PI-AVH 196

  Fly  1243 CSAGIGRTGCFTAILNAVRQLRQSLAYSLTGMLTKSLTSSSTEEYHNPTDSDSSFTCNTIRHISH 1307
            |||||||||....:...:.||       |.|.:.:              |:|.            
 Worm   197 CSAGIGRTGSVVMLEYVMDQL-------LAGQIIE--------------DTDK------------ 228

  Fly  1308 ILDHRDAEAVKTPPSFDRLPKMPDIFVDVLGIVCNLRLQRGGMVQNSEQYELIHRAICLYLKR 1370
                                           |:..:|.||...||...||..:|:.:..:.::
 Worm   229 -------------------------------IIQKIREQRNNSVQTDHQYLFVHQVMMNFFEK 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTP-ERNP_726092.1 Y_phosphatase 916..1364 CDD:278528 86/445 (19%)
PTPc 917..1364 CDD:238006 86/445 (19%)
K07F5.8NP_501766.1 Y_phosphatase 19..256 CDD:278528 86/447 (19%)
PTPc 20..256 CDD:238006 86/447 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.