DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTP-ER and B0280.11

DIOPT Version :9

Sequence 1:NP_726092.1 Gene:PTP-ER / 37461 FlyBaseID:FBgn0016641 Length:1377 Species:Drosophila melanogaster
Sequence 2:NP_498560.2 Gene:B0280.11 / 175997 WormBaseID:WBGene00015106 Length:441 Species:Caenorhabditis elegans


Alignment Length:367 Identity:67/367 - (18%)
Similarity:119/367 - (32%) Gaps:137/367 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   826 DHSYQTNRNIIEQPPVLGSNARD---VETPTDMVPPSSEDSELLASYQTVVSRMAQPIPELKENE 887
            |:..:|:.|.:|........|:|   :|...:...||...|       |:..|.|:...||..| 
 Worm    61 DNKTKTDTNRMEVTAKGFKKAKDAKKLEKKKEETGPSKTPS-------TIALRRAESQMELSGN- 117

  Fly   888 QKRIFRDLHKEFWDLPLNHQEKPMVFGSQTKNRYKTILPNENSRVLLESESSELTSLLGEIKRTS 952
            :|.:.:.:  :.|   :...||.:......:..:|   |.:..:|.||...:        .|:..
 Worm   118 RKNVEKGV--KTW---VEQLEKLVEIRKLLEADFK---PIDTMKVDLEKCQA--------FKKNI 166

  Fly   953 SVTASEDLPYINANYIKG---------------PDYVSKCYVATQGPL---PNTIFEFWLMIYQN 999
            ....||::...:||.:||               |...:|..:..|.||   |:::..||||    
 Worm   167 DYCQSENVELYDANRVKGGGEADFFYHATVTSIPSISTKSTILAQLPLSDSPHSLESFWLM---- 227

  Fly  1000 TQRYIRRCVDGGSSSSPHVDREQILQQYFQKIVMLTNFTEANRQKCAVYFPIELNEI-------- 1056
                                   :..|..|::.:|....|.::...:.|||.:..|.        
 Worm   228 -----------------------VAAQKIQRLFILIGEDELDKAALSEYFPEDFKEFKTIRVNNR 269

  Fly  1057 ---------------------------FAVAAKCEVF-----------QLSAAARDYFDRYLTPT 1083
                                       ||:...|:.:           :::|.|...||..:   
 Worm   270 KTVSKSDEQPNTQLYYEVVPKDCAEAPFAMIEICDFWPDGKIPTVSYGRIAATAASVFDSDI--- 331

  Fly  1084 FVPDTVVASSDAIDYEIS----GRH----IGVESVKVTLEGD 1117
                    .|||....:|    ||.    :||::::....||
 Worm   332 --------DSDATCAIVSNYGAGRAGSFLVGVQAIEKLQAGD 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTP-ERNP_726092.1 Y_phosphatase 916..1364 CDD:278528 47/274 (17%)
PTPc 917..1364 CDD:238006 47/273 (17%)
B0280.11NP_498560.2 PTPc 141..398 CDD:214550 47/274 (17%)
PTPc 177..394 CDD:304379 39/227 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.