DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTP-ER and Y54F10BM.3

DIOPT Version :9

Sequence 1:NP_726092.1 Gene:PTP-ER / 37461 FlyBaseID:FBgn0016641 Length:1377 Species:Drosophila melanogaster
Sequence 2:NP_001368044.1 Gene:Y54F10BM.3 / 175350 WormBaseID:WBGene00021858 Length:622 Species:Caenorhabditis elegans


Alignment Length:253 Identity:54/253 - (21%)
Similarity:84/253 - (33%) Gaps:95/253 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   864 ELLASYQTVV---SRMAQPIPELKENE---QKRIFRDLHKEF------------------WD--- 901
            |||.....:|   .:..:|..||:|||   :::...|:.|:.                  |.   
 Worm   152 ELLPMEDVIVKNKEKFKKPQNELRENEVWVERQTGPDIDKDSDPKTENALDEQDYQLEDGWHGKS 216

  Fly   902 -LPLNHQEKPMVFGSQTKNRY----------------KTILPNENSRVLLESE-SSELTSLLG-- 946
             |.:..:|...:|   ||..|                ||::.|.......|.| ..|||::..  
 Worm   217 ALNITRKEFKKLF---TKMSYSPSMCSIIPGKERDPSKTVIANWFEWCQPEFEIPIELTAMSAGN 278

  Fly   947 -EIKRTSSVTA-------SEDLPYINANYIKGP--DYVSKCYVATQGPL-------PNTIFEFWL 994
             ::.|...|.|       .:|..:|:|:.:..|  :|:.|..:. |.|.       |:|...||.
 Worm   279 PKLCRDPKVQAWDSTSYLVDDTHFIHASTVTAPGKEYIGKAIIC-QAPFDDKEKGHPDTRESFWR 342

  Fly   995 MIYQNTQRYIRRCVDGGSSSSPHVDREQILQQYFQKIVMLTNFTEANRQKCAVYFPIE 1052
            |::.....|                           :||.....|...|||..|||.|
 Worm   343 MVWDTRATY---------------------------VVMCCQIMENGVQKCGRYFPDE 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTP-ERNP_726092.1 Y_phosphatase 916..1364 CDD:278528 38/173 (22%)
PTPc 917..1364 CDD:238006 38/172 (22%)
Y54F10BM.3NP_001368044.1 Y_phosphatase 278..515 CDD:395053 27/124 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.