DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PTP-ER and Ptpn12

DIOPT Version :9

Sequence 1:NP_726092.1 Gene:PTP-ER / 37461 FlyBaseID:FBgn0016641 Length:1377 Species:Drosophila melanogaster
Sequence 2:NP_476456.2 Gene:Ptpn12 / 117255 RGDID:620894 Length:766 Species:Rattus norvegicus


Alignment Length:527 Identity:123/527 - (23%)
Similarity:177/527 - (33%) Gaps:241/527 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   861 EDSELLASYQTVVSRMAQPIPELKENEQKRIFRD------LHKEFWDLPLNHQEK--PMVFGSQ- 916
            |..|:|..:...|..|..|    ..|.:....||      |..::      ..||  |...|.: 
  Rat     2 EQVEILRRFIQRVQAMKSP----DHNGEDNFARDFMRLRRLSTKY------RTEKIYPTATGEKE 56

  Fly   917 ---TKNRYKTILPNENSRVLLESESSELTSLLGEIKRTSSVTASEDLPYINANYIKGPDYVSKCY 978
               .|||||.|||.::|||.|..:                 |.|:|..|||||:|||. |..:.|
  Rat    57 ENVKKNRYKDILPFDHSRVKLTLK-----------------TPSQDSDYINANFIKGV-YGPRAY 103

  Fly   979 VATQGPLPNTIFEFWLMIYQNTQRYIRRCVDGGSSSSPHVDREQILQQYFQKIVMLTNFTEANRQ 1043
            |||||||.||:.:||.||::..                           ...|||.....|..|:
  Rat   104 VATQGPLANTVIDFWRMIWEYN---------------------------VVIIVMACREFEMGRK 141

  Fly  1044 KCAVYFPIELNEIFAVAAKCEVFQLSAAARDYFDRYLTPTFVPDTVVASSDAIDYEISGRHIGVE 1108
            ||..|:|:                       |.:..:  ||.|                      
  Rat   142 KCERYWPL-----------------------YGEDPI--TFAP---------------------- 159

  Fly  1109 SVKVTLEGDLLEALPAQGSFFLIKNVGIVRRNGYSVRKLVLLYCIRVPQSASYHLQKIYCYHYWY 1173
             .|::.|.:                   ..|..|.:|.|:|.:     |:.|   :::|.:|  |
  Rat   160 -FKISCENE-------------------QARTDYFIRTLLLEF-----QNES---RRLYQFH--Y 194

  Fly  1174 PDWPDHHSPRDINTLLDTCLHVLNLGKCESEFDIYDDTRSERNAHLAAQRLEIYQQDIFNAVQPL 1238
            .:||||..|...:::||    :::|                         :..||:.     :.:
  Rat   195 VNWPDHDVPSSFDSILD----MISL-------------------------MRKYQEH-----EDV 225

  Fly  1239 PV-IHCSAGIGRTGCFTAILNAVRQLRQSLAYSLTGMLTKSLTSSSTEEYHNPTDSDSSFTCNTI 1302
            |: ||||||.||||...||                                       .:|.|.:
  Rat   226 PICIHCSAGCGRTGAICAI---------------------------------------DYTWNLL 251

  Fly  1303 RHISHILDHRDAEAVKTPPSFDRLPKMPDIFVDVLGIVCNLRLQRGGMVQNSEQYELIHRAICLY 1367
            :            |.|.|..|           :|..::..:|.||...||..|||||:||||...
  Rat   252 K------------AGKIPEEF-----------NVFNLIQEMRTQRHSAVQTKEQYELVHRAIAQL 293

  Fly  1368 LKRTLAL 1374
            .::.|.|
  Rat   294 FEKQLQL 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PTP-ERNP_726092.1 Y_phosphatase 916..1364 CDD:278528 105/452 (23%)
PTPc 917..1364 CDD:238006 105/447 (23%)
Ptpn12NP_476456.2 PTPc 28..292 CDD:214550 114/487 (23%)
PTPc 60..292 CDD:238006 107/449 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0789
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.