DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and KCTD10

DIOPT Version :9

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001304324.1 Gene:KCTD10 / 83892 HGNCID:23236 Length:314 Species:Homo sapiens


Alignment Length:136 Identity:41/136 - (30%)
Similarity:74/136 - (54%) Gaps:22/136 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 AAAAAAVGGASSAGASSYLHGNHKPITGIPCVAAASRYTAPVHIDVGGTIYTSSLETLTKYPESK 160
            |..|||....|..|.|                 .:|:|   |.::|||.:|.::::|||| .::.
Human    13 AVPAAATRTTSFKGTS-----------------PSSKY---VKLNVGGALYYTTMQTLTK-QDTM 56

  Fly   161 LAKLFNGQIPIVLDSLKQHYFIDRDGGMFRHILNFMRNSRLLIAEDFPDLELLLEEARYYEVEPM 225
            |..:|:|::.::.|| :....|||.|..|..|||::|:..:.:.|...::|.||.||:||.|:.:
Human    57 LKAMFSGRMEVLTDS-EGWILIDRCGKHFGTILNYLRDGAVPLPESRREIEELLAEAKYYLVQGL 120

  Fly   226 IKQLES 231
            :::.::
Human   121 VEECQA 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 32/92 (35%)
KCTD10NP_001304324.1 BTB_POZ_KCTD10_BACURD3 26..136 CDD:349707 36/123 (29%)
PCNA-binding. /evidence=ECO:0000250 240..246
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.