DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and AT2G24240

DIOPT Version :9

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_180001.1 Gene:AT2G24240 / 816958 AraportID:AT2G24240 Length:441 Species:Arabidopsis thaliana


Alignment Length:276 Identity:61/276 - (22%)
Similarity:98/276 - (35%) Gaps:99/276 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 VHIDVGGTIYTSSLETLTKY-PESKLAKLFNGQ--IPIVLDSLKQHYFIDRDGGMFRHILNFMRN 198
            :..:|||.::.::..||... .:|....||:.:  :..:.||:   .|:||:...|..:|:.:|.
plant     8 IKFNVGGRLFETTATTLANAGRDSFFGALFDDEWNLSPLEDSI---LFVDRNSDCFAVLLDLLRT 69

  Fly   199 SRLLIAEDFPDLELLLEEARYYEVEPMIKQLESMRKDRVR-------NGNYL--------VAPPT 248
            ..|.:..:.|: .||..||.:|.:           .|.||       :||.|        :||..
plant    70 GDLNVPANIPE-RLLHREASFYGL-----------LDHVRTAKWGPFDGNRLRLSDSVKGIAPGD 122

  Fly   249 PPARHIKTSPRTSASPECNYEVVALHI--------SP---------DLG----ERIMLSAERALL 292
            ..|  |:..|....   |......:|:        ||         |:|    :.|:|||...| 
plant   123 GTA--IRAGPDGGC---CVAHGSVVHVFDWMLEEHSPINLDYQRVNDVGWIDSDNIVLSACEKL- 181

  Fly   293 DELFPEASQATQSSRSGVSWNQGDWGQIIRFPLNG-------YCKLNSVQVLTRLLNAG------ 344
                                .:||.|..:....:|       .|..|.|:..|    ||      
plant   182 --------------------GRGDGGMGLFSSSSGDLRYKFQVCHENQVKSYT----AGALSFSP 222

  Fly   345 -FTIEASVGGQQFSEY 359
             :.|.||..|:. :||
plant   223 DYEIFASCKGRS-NEY 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 23/95 (24%)
AT2G24240NP_180001.1 BTB_POZ_KCTD-like 8..90 CDD:349625 22/85 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14499
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.970

Return to query results.
Submit another query.