DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and kctd4

DIOPT Version :9

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001002224.1 Gene:kctd4 / 792402 ZFINID:ZDB-GENE-040704-71 Length:258 Species:Danio rerio


Alignment Length:119 Identity:43/119 - (36%)
Similarity:69/119 - (57%) Gaps:14/119 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 KPITGIPCVAAASRYTAPVHIDVGGTIYTSSLETLTKYPESKLAKLFNGQIPIV-LDSLKQHYFI 182
            ||.:|            .:.|:|||.:|.:...||.|:|.|.|.::..|:.|:: :||: .:.||
Zfish    28 KPSSG------------TITINVGGYLYAAQRHTLAKHPGSLLEEMVTGKKPVLHVDSM-GNTFI 79

  Fly   183 DRDGGMFRHILNFMRNSRLLIAEDFPDLELLLEEARYYEVEPMIKQLESMRKDR 236
            ||||.:|||||||:|...|::.|||.:.|||..||.:|.:..:.:.|:...:.:
Zfish    80 DRDGPIFRHILNFLRLGELVLPEDFKETELLRREANFYRLSELAQALQDWEQQQ 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 39/93 (42%)
kctd4NP_001002224.1 BTB 34..133 CDD:197585 40/99 (40%)
BTB 34..123 CDD:295341 39/89 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170591939
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2723
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.