DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and KCTD15

DIOPT Version :9

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001123466.1 Gene:KCTD15 / 79047 HGNCID:23297 Length:283 Species:Homo sapiens


Alignment Length:269 Identity:129/269 - (47%)
Similarity:175/269 - (65%) Gaps:34/269 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 GASSAGASSYLHGNHKPIT-----GIPCVAAASRYTAPVHIDVGGTIYTSSLETLTKYPESKLAK 163
            |.:..|..|.|.....|::     |||..|..::..|||||||||.:|||||.||||||:|::::
Human    20 GTAEGGNMSRLSLTRSPVSPLAAQGIPLPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPDSRISR 84

  Fly   164 LFNGQIPIVLDSLKQHYFIDRDGGMFRHILNFMRNSRLLIAEDFPDLELLLEEARYYEVEPMIKQ 228
            ||||..|||||||||||||||||.:||::|:|:|.|:||:.:||.|..||.||||||:::||:::
Human    85 LFNGTEPIVLDSLKQHYFIDRDGEIFRYVLSFLRTSKLLLPDDFKDFSLLYEEARYYQLQPMVRE 149

  Fly   229 LESMRKDRVRNGNYLVAPPTPPARHIKTSPRTSASPECNYEVVALHISPDLGERIMLSAERALLD 293
            ||..::::.:.                   |.|.:.:|    :.:.::|||||||.||.|:||::
Human   150 LERWQQEQEQR-------------------RRSRACDC----LVVRVTPDLGERIALSGEKALIE 191

  Fly   294 ELFPEASQATQSSRSGVSWNQGDWGQIIRFPLNGYCKLNSVQVLTRLLNAGFTIEASVGG----Q 354
            |:|||......:| ....||| |...:|||||||||:|||||||.||...||::.||.||    .
Human   192 EVFPETGDVMCNS-VNAGWNQ-DPTHVIRFPLNGYCRLNSVQVLERLFQRGFSVAASCGGGVDSS 254

  Fly   355 QFSEYLLAR 363
            |||||:|.|
Human   255 QFSEYVLCR 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 61/92 (66%)
KCTD15NP_001123466.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32 4/11 (36%)
BTB_POZ_KCTD15 55..153 CDD:349696 65/97 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156331
Domainoid 1 1.000 135 1.000 Domainoid score I4984
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11450
Inparanoid 1 1.050 238 1.000 Inparanoid score I3374
Isobase 1 0.950 - 0 Normalized mean entropy S4982
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D412532at33208
OrthoFinder 1 1.000 - - FOG0002897
OrthoInspector 1 1.000 - - otm41604
orthoMCL 1 0.900 - - OOG6_108738
Panther 1 1.100 - - LDO PTHR14499
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5816
SonicParanoid 1 1.000 - - X1912
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.840

Return to query results.
Submit another query.