DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and kctd2

DIOPT Version :9

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001038899.1 Gene:kctd2 / 751724 ZFINID:ZDB-GENE-060825-85 Length:267 Species:Danio rerio


Alignment Length:220 Identity:63/220 - (28%)
Similarity:101/220 - (45%) Gaps:41/220 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 LEPRDLSSTGRIYARSDIKISSSPTVSPTISNSSSPTPT---PPASSSVTPLGLPGAVAAAAAAV 102
            :||   ::||.|......:|..|.:|       ..|:||   ||.|.    |..||...:.|...
Zfish     6 VEP---NATGIIEQPEHCEIRGSVSV-------RLPSPTLVIPPRSG----LSSPGVSGSRAVFG 56

  Fly   103 GGASSAGASSYLHGNHKPITGIPCVAAASRYTAPVHIDVGGTIYTSSLETLTKYPESKLAKLFNG 167
            ....|...|.......||         .||:   |.::||||.:.::.:||.:.|:|.|.:|.  
Zfish    57 FPMKSNPTSPSPEATEKP---------GSRW---VRLNVGGTYFVTTKQTLCRDPKSFLYRLC-- 107

  Fly   168 QIPIVLDSLKQH---YFIDRDGGMFRHILNFMRNSRLLIAEDFPDLELLLEEARYYEVEPMIKQL 229
            |....|||.|..   |.||||...|..|||::|:.:|:|.::..: |.:||||.:|.:..:::  
Zfish   108 QEDPDLDSDKDETGAYLIDRDPTYFGPILNYLRHGKLIINKNLAE-EGVLEEAEFYNIASLVR-- 169

  Fly   230 ESMRKDRVRNGNYLVAPPTPPARHI 254
              :.|:|:|:.....:  ..|.:|:
Zfish   170 --LVKERIRDNENRTS--QGPVKHV 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 34/95 (36%)
kctd2NP_001038899.1 BTB 78..179 CDD:197585 37/110 (34%)
BTB_2 79..167 CDD:280393 34/90 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.