DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and kctd7

DIOPT Version :9

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001038798.2 Gene:kctd7 / 735248 ZFINID:ZDB-GENE-060804-2 Length:339 Species:Danio rerio


Alignment Length:204 Identity:57/204 - (27%)
Similarity:91/204 - (44%) Gaps:37/204 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 SPTVSPTISNSSSPTPTPPASSSVTPLGLPGAV-----------AAAAAAVGGASSAGASSYLHG 116
            :|...|...:.|:..|...|:|.|......|..           ||:.:...|.:.:||......
Zfish     9 TPNGEPPPLSFSAAAPLQMATSRVRRFAQEGRTVPQPRVMVVFSAASDSEKPGDAMSGADKGEEE 73

  Fly   117 NHKPITGIP-----------CVAAASRYTAPVHIDVGGTIYTSSLETLTKYPESKLAKLFNGQIP 170
            ..||  .||           .:.|...:...:.::||||.:|:.|.||.:|.::.||.:|:|:..
Zfish    74 YRKP--AIPVANLNLAKSLRTLDAPEEFPEVIPLNVGGTYFTTRLSTLRRYEDTMLAAMFSGRHH 136

  Fly   171 IVLDSLKQHYFIDRDGGMFRHILNFMRNSRLLIAEDFPD---LELLLEEARYYEVEPMIKQLES- 231
            |..|: :..|||||||..|..||||:|...|      |.   :..:..||:||.:.|:::.||. 
Zfish   137 IPRDA-EGRYFIDRDGTYFGDILNFLREGEL------PQRDRVRAVHREAQYYAIGPLLENLEDT 194

  Fly   232 --MRKDRVR 238
              :..::||
Zfish   195 QPLTGEKVR 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 35/95 (37%)
kctd7NP_001038798.2 BTB 105..193 CDD:197585 36/94 (38%)
BTB 105..188 CDD:295341 35/89 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170591937
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2723
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.