DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and Kctd6

DIOPT Version :9

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001292865.1 Gene:Kctd6 / 71393 MGIID:1918643 Length:237 Species:Mus musculus


Alignment Length:98 Identity:47/98 - (47%)
Similarity:69/98 - (70%) Gaps:1/98 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 PVHIDVGGTIYTSSLETLTKYPESKLAKLFNGQIPIVLDSLKQHYFIDRDGGMFRHILNFMRNSR 200
            ||.::|||.:||:||.|||:||:|.|..:|.|..|...|. :.:|||||||.:||::|||:|.|.
Mouse    13 PVTLNVGGHLYTTSLTTLTRYPDSMLGAMFGGDFPTARDP-QGNYFIDRDGPLFRYVLNFLRTSE 76

  Fly   201 LLIAEDFPDLELLLEEARYYEVEPMIKQLESMR 233
            |.:..||.:.:||.:||.:|::||:|:.|...|
Mouse    77 LTLPLDFKEFDLLRKEADFYQIEPLIQCLNDPR 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 44/92 (48%)
Kctd6NP_001292865.1 Interaction with ANK1 isoform Mu7. /evidence=ECO:0000250|UniProtKB:Q8NC69 1..104 45/91 (49%)
BTB_POZ 10..113 CDD:365784 47/98 (48%)
Interaction with CUL3. /evidence=ECO:0000250|UniProtKB:Q8NC69 10..110 47/98 (48%)
Interaction with USP21. /evidence=ECO:0000250|UniProtKB:Q8NC69 113..187
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846735
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2723
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.