DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and Kctd4

DIOPT Version :9

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001103120.1 Gene:Kctd4 / 691835 RGDID:1594637 Length:259 Species:Rattus norvegicus


Alignment Length:262 Identity:72/262 - (27%)
Similarity:117/262 - (44%) Gaps:83/262 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 IDVGGTIYTSSLETLTKYPESKLAKLFNGQIPIVLDSLKQHYFIDRDGGMFRHILNFMRNSRLLI 203
            ::|||.:|.:..:||||||::.|..:.||:|....|: ..||||||||.:|||:|||:||..||:
  Rat    37 LNVGGYLYITQRQTLTKYPDTFLEGIVNGKILCPFDA-DGHYFIDRDGLLFRHVLNFLRNGELLL 100

  Fly   204 AEDFPDLELLLEEARYYEVEPMIKQLESMRKDRVRNGNYLVAPPTPPARHIKTSPRTSASPE--- 265
            .|.|.:.:||.:||.:::::.:.::::|..|..                  :.:||.:...|   
  Rat   101 PEGFRENQLLAQEAEFFQLKGLAEEVKSRWKKE------------------QLTPRETTFLEITD 147

  Fly   266 -----------CNYEVVALHISPD----LGERIMLSAERALLDELFPEASQATQSSRSGVSWNQG 315
                       ||        :||    :..||:|.::..|  :.|||        ...||.|  
  Rat   148 NHDRSQGLRIFCN--------APDFISKIKSRIVLVSKSRL--DGFPE--------EFSVSSN-- 192

  Fly   316 DWGQIIRFPL-----NG-----------YCKLNSV--QVLTRLLNAGF----TIEASVGGQQFSE 358
                ||:|..     ||           .|.|.::  :.:...|..||    :::.|.|....|:
  Rat   193 ----IIQFKYFIKSENGTRLVLKEDNTFVCTLETLKFEAIMMALKCGFRLLTSLDCSKGSIVHSD 253

  Fly   359 YL 360
            .|
  Rat   254 AL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 39/90 (43%)
Kctd4NP_001103120.1 BTB_POZ_KCTD4 34..119 CDD:349673 39/82 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350268
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2723
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.