DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and LOC681355

DIOPT Version :9

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_003752068.1 Gene:LOC681355 / 681355 RGDID:1596735 Length:292 Species:Rattus norvegicus


Alignment Length:290 Identity:64/290 - (22%)
Similarity:121/290 - (41%) Gaps:72/290 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 SRYTAPVHIDVGGTIYTSSLETLTKYPESKLAKLFNGQIP--IVLDSLKQHYFIDRDGGMFRHIL 193
            |.:...:.::|||.:|.:...||...|.|:|.::|:.:.|  ::.|: |..:||||||.:||::|
  Rat    17 SSFPEIIELNVGGQVYITRYPTLISIPGSRLWEMFSVKNPCSLIQDN-KGRFFIDRDGFLFRYVL 80

  Fly   194 NFMRNSRLLIAEDFPDLELLLEEARYYEVEPMIK-------QLESMRKDRVR------------- 238
            ::||:.::::.:.||:...|..||.|:::..:.|       :|.|:..|..:             
  Rat    81 DYMRDMQVVLPDHFPECGRLHREAEYFKLPELAKMLALKMNKLNSIGNDSCQIDLDELSPSIDTT 145

  Fly   239 ------NGNYLVAPPTPPARHIKTSPRTSASPECNYEVVALHISPDLGE------------RIML 285
                  |..::..|..|.   :.|:...|...:..:..:....|..||.            |||:
  Rat   146 FNFSSTNSIHISGPDNPV---VLTAAPGSELKKAGFITIGYRGSYTLGRDSQTDAKFRRVARIMV 207

  Fly   286 SAERALLDELFPEA-SQATQSSRSGVSWNQGDWGQIIRFPLNGYCKLNSV-QVLTRLLNAGFTIE 348
            ..:.:|..|:|.:. :::....|...           |:....|.|...: |...:|.:|||.:.
  Rat   208 CGKISLAKEVFGDTLNESRDPDRPPE-----------RYTSRYYLKFTFLEQAFDKLADAGFHMV 261

  Fly   349 A--SVG-------------GQQFSEYLLAR 363
            |  |.|             ...::||:..|
  Rat   262 ACNSTGTCTVTHDQTDDRIWTSYTEYVFYR 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 31/101 (31%)
LOC681355XP_003752068.1 BTB 23..113 CDD:295341 30/90 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350271
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2723
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.