DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and KCTD14

DIOPT Version :9

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_076419.2 Gene:KCTD14 / 65987 HGNCID:23295 Length:255 Species:Homo sapiens


Alignment Length:114 Identity:38/114 - (33%)
Similarity:69/114 - (60%) Gaps:8/114 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 VHIDVGGTIYTSSLETLTKYPESKLAKLFNGQIPIVLDSLKQHYFIDRDGGMFRHILNFMRNSRL 201
            |.::|||..:|::|.||.|:|.||||::|:.......|: :..:||||....||.||:::|..: 
Human    35 VELNVGGEFHTTTLGTLRKFPGSKLAEMFSSLAKASTDA-EGRFFIDRPSTYFRPILDYLRTGQ- 97

  Fly   202 LIAEDFPDLELLLEEARYYEVEPMIKQLESMRK---DRVRNGNYLVAPP 247
            :..:..|:   :..||::||::|::|.||.|.:   ::|....:|:..|
Human    98 VPTQHIPE---VYREAQFYEIKPLVKLLEDMPQIFGEQVSRKQFLLQVP 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 32/92 (35%)
KCTD14NP_076419.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
BTB 35..125 CDD:197585 34/94 (36%)
BTB 35..118 CDD:295341 30/87 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156335
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2723
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.