DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and Kctd21

DIOPT Version :9

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001034128.2 Gene:Kctd21 / 622320 MGIID:3643121 Length:260 Species:Mus musculus


Alignment Length:262 Identity:75/262 - (28%)
Similarity:121/262 - (46%) Gaps:71/262 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 PVHIDVGGTIYTSSLETLTKYPESKLAKLFNGQIPIVLDSLKQHYFIDRDGGMFRHILNFMRNSR 200
            |:.::|||.:||:||.|||.:|:|.|..:|:|::|...|| :.:.||||||.:||:||||:|.|.
Mouse     4 PITLNVGGKLYTTSLATLTSFPDSMLGAMFSGKMPTKRDS-QGNCFIDRDGKVFRYILNFLRTSH 67

  Fly   201 LLIAEDFPDLELLLEEARYYEVEPMIKQLESMR----------------KDRVRNGNYLVAPPTP 249
            |.:.|||.::.||..||.:|:|:|:|:.|:...                |.||:..::.|     
Mouse    68 LDLPEDFQEMGLLRREADFYQVQPLIEALQEKEVELSKAEKNAMLNITLKQRVQTVHFTV----- 127

  Fly   250 PARHIKTSPRTSASPECNYEVVALHISPD-------LGERIMLSAERAL--------------LD 293
                 :.:|:..:....:.||...:|...       ||.::...:...|              ||
Mouse   128 -----REAPQIYSLSSSSMEVFNANIFSTSCLFLKLLGSKLFYCSNGNLSSITSHLQDPNHLTLD 187

  Fly   294 -----ELFPEASQATQSSRSGVSWNQGDWGQIIRFPLNGYCKLNSVQ-----VLTRLLNAGFTIE 348
                 |..||.....|:.:           ::...|.|.  ::||.|     ||...|:.||.|:
Mouse   188 WVANVEGLPEEEYTKQNLK-----------RLWVVPANK--QINSFQVFVEEVLKIALSDGFCID 239

  Fly   349 AS 350
            :|
Mouse   240 SS 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 44/92 (48%)
Kctd21NP_001034128.2 BTB_POZ_KCTD21 3..100 CDD:349703 46/96 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846736
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2723
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.