DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and kcnd2

DIOPT Version :9

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001076336.1 Gene:kcnd2 / 570188 ZFINID:ZDB-GENE-041210-70 Length:630 Species:Danio rerio


Alignment Length:282 Identity:63/282 - (22%)
Similarity:105/282 - (37%) Gaps:78/282 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 SAGASSYLHGNHKPITGIPCVAAASRYTAP----------VHIDVGGTIYTSSLETLTKYPESKL 161
            :||.:::|........|...||:|.....|          :.::|.||.:.:...||.:||::.|
Zfish     2 AAGVAAWLPFARAAAIGWMPVASAPMPPPPRDKKRGQDGLIILNVSGTRFQTWRNTLERYPDTLL 66

  Fly   162 AK-----LFNGQIPIVLDSLKQHYFIDRDGGMFRHILNFMRNSRLLIAEDFPDLELLL---EEAR 218
            ..     .|:.:        ...||.|||..:|||||||.|..:|    .:|..|.:.   ||..
Zfish    67 GSTERDFFFHEE--------TNEYFFDRDPDIFRHILNFYRTGKL----HYPRHECISAYDEELA 119

  Fly   219 YYEVEPMI------KQLESMRKDRVR---------NGNYLVAPPTPPARHI---KTSPRTSASPE 265
            ::.:.|.|      ::.:..|::...         |.|.||.|.......:   ..:|.||....
Zfish   120 FFGIIPEIIGDCCYEEYKDRRRENAERIQDDEENDNNNDLVMPDLSFRESMWRAFENPHTSTMAL 184

  Fly   266 CNYEVVALHISPDLGERIMLSAERALLDELFPEASQATQSSRSGVSWNQG---DWGQIIRFPLNG 327
            ..|.|....|:..:...::         |..|          .|:|.|:.   ..|:  |:.|..
Zfish   185 VFYYVTGFFIAVSVMANVV---------ETVP----------CGISLNRAKELSCGE--RYALAF 228

  Fly   328 YC------KLNSVQVLTRLLNA 343
            :|      .:.:|:.|.||:.|
Zfish   229 FCLDTACVMIFTVEYLLRLIAA 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 29/106 (27%)
kcnd2NP_001076336.1 Shal-type 3..28 CDD:288455 7/24 (29%)
BTB 42..139 CDD:197585 29/108 (27%)
BTB_2 42..131 CDD:280393 29/100 (29%)
Ion_trans 228..416 CDD:278921 6/23 (26%)
Ion_trans_2 330..410 CDD:285168
DUF3399 444..548 CDD:288712
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.