DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and kctd8

DIOPT Version :9

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001032318.1 Gene:kctd8 / 568933 ZFINID:ZDB-GENE-060117-3 Length:280 Species:Danio rerio


Alignment Length:267 Identity:70/267 - (26%)
Similarity:117/267 - (43%) Gaps:45/267 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 TGIPCVAAASRYTAPVHIDVGGTIYTSSLETLTKYPESKLAKLFNGQIPIVL--DSLKQHYFIDR 184
            |.:|....:|.|...|.::|||.:|.:...||...|::.|..:|....|..|  || :..:||||
Zfish     6 TILPISEVSSPYPEVVELNVGGQVYVTKRSTLVSVPDTTLHTMFTRCTPHELPRDS-RGRFFIDR 69

  Fly   185 DGGMFRHILNFMRNSRLLIAEDFPDLELLLEEARYYEVEPMIKQL-------------------- 229
            ||.:||::|:|:|:.:|::.|.||:.|.|..||.::::..:::.|                    
Zfish    70 DGFLFRYVLDFLRDRQLVLPEHFPERERLQREAEHFQLGELLRLLGPRVAKQGSLNDEGCQSDIE 134

  Fly   230 ESMRKDRV--RNGNYLVAPPTPPARHIKTSPRTSASPECNYEVVALHISPDLG----ERIMLSAE 288
            ||.:...:  |.|::.:...|..:...|.|...:.....:|.:|..: ..|..    .|||:...
Zfish   135 ESSQSSELVTRTGHHAINYATTSSTLDKRSGFITIGYRGSYTMVRDN-QADAKFRRVARIMVCGR 198

  Fly   289 RALLDELFPEA-SQATQSSRSGVSWNQGDWGQIIRFPLNGYCKLNSV-QVLTRLLNAGFTIEA-- 349
            .||..|:|.:. :::....|....:..       ||    |.|...: |...||..|||.:.|  
Zfish   199 IALAKEVFGDTLNESRDPDRPPEKYTS-------RF----YLKFTYLEQAFDRLSEAGFQMVACN 252

  Fly   350 SVGGQQF 356
            |.|...|
Zfish   253 STGTAAF 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 34/114 (30%)
kctd8NP_001032318.1 BTB 21..113 CDD:197585 33/92 (36%)
BTB 21..111 CDD:295341 33/90 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170591943
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.