DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and kctd16a

DIOPT Version :9

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001032315.1 Gene:kctd16a / 567207 ZFINID:ZDB-GENE-060117-1 Length:285 Species:Danio rerio


Alignment Length:96 Identity:35/96 - (36%)
Similarity:60/96 - (62%) Gaps:3/96 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 VHIDVGGTIYTSSLETLTKYPESKLAKLFNGQIPIVLD---SLKQHYFIDRDGGMFRHILNFMRN 198
            |.::|||.:|.:...|||..|.|.|.|||:.:..|..|   .:|..|||||||.:||::|:::|:
Zfish    27 VELNVGGQVYYTRHATLTSVPNSLLGKLFSSKKDISNDLTQDIKGRYFIDRDGFLFRYVLDYLRD 91

  Fly   199 SRLLIAEDFPDLELLLEEARYYEVEPMIKQL 229
            ..:::.:.||:...|..||.::::..::|.|
Zfish    92 KTVVLPDYFPEKGRLKREAEFFQLPELVKIL 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 35/96 (36%)
kctd16aNP_001032315.1 BTB 25..120 CDD:197585 33/92 (36%)
BTB 27..118 CDD:295341 33/90 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170591945
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.