DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and kctd14

DIOPT Version :9

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_693041.2 Gene:kctd14 / 564616 ZFINID:ZDB-GENE-120215-239 Length:241 Species:Danio rerio


Alignment Length:151 Identity:48/151 - (31%)
Similarity:81/151 - (53%) Gaps:15/151 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 VHIDVGGTIYTSSLETLTKYPESKLAKLFNGQIPIVLDSLKQHYFIDRDGGMFRHILNFMRNSRL 201
            ||:::||.:::::|.|:.|:|.|.||:|.||... .:|| :..|||||||.:|.|||.::|..:|
Zfish    24 VHLNIGGHVFSTTLGTIRKFPNSTLAELINGSSK-RMDS-EGRYFIDRDGTLFTHILEYLRTEKL 86

  Fly   202 LIAEDFPDLELLLEEARYYEVEPMIKQLESMRK---DRVRNGNYLVAPPTPPARHIKTSPRTS-- 261
                ....|:.:.:||.||:::|::|.:|...:   :.|....:|...|. ...:::...|.:  
Zfish    87 ----PCEHLQEVHKEAIYYDIKPLVKAIEETPQFFGETVGRQQFLARVPN-YRENLEVIVRVARA 146

  Fly   262 ---ASPECNYEVVALHISPDL 279
               ||...|..|..|....||
Zfish   147 EAIASRHSNIIVCVLRTEDDL 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 36/92 (39%)
kctd14XP_693041.2 BTB 24..112 CDD:197585 36/93 (39%)
BTB 24..106 CDD:295341 34/87 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170591938
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.