DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and shkbp1

DIOPT Version :9

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_001920935.4 Gene:shkbp1 / 562395 ZFINID:ZDB-GENE-130415-1 Length:841 Species:Danio rerio


Alignment Length:177 Identity:56/177 - (31%)
Similarity:87/177 - (49%) Gaps:24/177 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 VHIDVGGTIYTSSLETLTKYPESKLAKLFNGQIPIVLDSLKQHYFIDRDGGMFRHILNFMRNSRL 201
            :|::|||..:::|.:|||..|:|..:.|.:|:|..:.|.... .|||||..:|..||||:|...|
Zfish     8 IHLNVGGKRFSTSRQTLTWVPDSFFSSLLSGRISTLKDETGA-IFIDRDPSLFAPILNFLRTKEL 71

  Fly   202 LIAEDFP---DLELLLEEARYYEVEPMIKQLESMRK-DRVRNGNYL----VAPPTPPA----RHI 254
                 .|   |:.||:.||.:|.:.|::::|:...: ||...||.|    :.||..|.    ||.
Zfish    72 -----HPRSIDVHLLIHEAEFYGITPLVRKLQLCDELDRSSCGNVLFNGYLPPPVYPVKRRNRHS 131

  Fly   255 KTSPRTSASPECNYEVVALHIS----PDLGERIMLSAERALLDELFP 297
            ...|:.........|...:..|    |:||...:|.  ||.::|..|
Zfish   132 VAGPQFMGGRSGPVERAPVRRSNTMPPNLGNAGILG--RAAVEERVP 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 34/95 (36%)
shkbp1XP_001920935.4 BTB 6..96 CDD:197585 34/93 (37%)
BTB_2 8..100 CDD:280393 35/97 (36%)
WD40 308..>569 CDD:225201
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.