DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and kctd12.2

DIOPT Version :9

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_001029191.1 Gene:kctd12.2 / 553403 ZFINID:ZDB-GENE-060117-4 Length:271 Species:Danio rerio


Alignment Length:279 Identity:66/279 - (23%)
Similarity:118/279 - (42%) Gaps:59/279 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 AAASRYTAPVHIDVGGTIYTSSLETLTKYPESKLAKLFNGQIP--IVLDSLKQHYFIDRDGGMFR 190
            |::.|::..:.::|||.:|.:...||...|.|.|..:|:.:.|  :..|| |..:|:||||.:||
Zfish     8 ASSPRFSEIIELNVGGQVYVTRHSTLLSVPNSLLWTMFSQKKPAELTTDS-KGRFFLDRDGFLFR 71

  Fly   191 HILNFMRNSRLLIAEDFPDLELLLEEARYYEVEPMIKQLESMRKDRVRNGNYL---VAPPTPPAR 252
            :||:::|:..|::.:.|.:...||:||.|::::.:.|:|    |..|...|.:   |....|...
Zfish    72 YILDYLRDQTLVLPDYFKEKASLLKEAEYFQLQDLAKRL----KPAVSKENSISEEVCQSDPEEA 132

  Fly   253 HIKTSPRTSASP--------ECNYEVVALHISPDLGE------------RIMLSAERALLDELFP 297
            .:..:..|...|        :..:..:....|..:|.            ||.:..:.:|..|:|.
Zfish   133 ALAGTSMTCTGPRSPSLDARKTGFITIGYRGSYTIGRDLQQDAKFRRVARITVCGKTSLAKEVFG 197

  Fly   298 EA-SQATQSSRSGVSWNQGDWGQIIRFPLNGYCKLNSV-QVLTRLLNAGFTIEA--SVG------ 352
            |. :::....|...           |:....|.|.|.: |...||...||.:.|  |.|      
Zfish   198 ETLNESRDPDRPPE-----------RYTSRYYLKYNFLEQAFDRLAEVGFHMVACSSTGTCAYAS 251

  Fly   353 --------GQQFSEYLLAR 363
                    ...::||:..|
Zfish   252 NDPNEDKIWTSYTEYVFCR 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 32/94 (34%)
kctd12.2NP_001029191.1 BTB 17..108 CDD:197585 31/91 (34%)
BTB 17..107 CDD:295341 31/90 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2723
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.