DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and kctd12b

DIOPT Version :9

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:XP_009305996.1 Gene:kctd12b / 550324 ZFINID:ZDB-GENE-050417-104 Length:443 Species:Danio rerio


Alignment Length:268 Identity:69/268 - (25%)
Similarity:116/268 - (43%) Gaps:46/268 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 TGIPCVAAASRYTAPVHIDVGGTIYTSSLETLTKYPESKLAKLFN--GQIPIVLDSLKQHYFIDR 184
            :|||....|  :...:.::|||.:|.:...|||..|:|.|.|:|:  ....:..|: |..:||||
Zfish     8 SGIPAEELA--FPEIIELNVGGQVYITRYLTLTSVPDSLLWKMFSQKSSKDLARDT-KGRFFIDR 69

  Fly   185 DGGMFRHILNFMRNSRLLIAEDFPDLELLLEEARYYEVEPMIKQLE--------------SMRKD 235
            ||.:||:||::||:.:|::.|.||:...|..||.::.:..:::.|.              ...:|
Zfish    70 DGFLFRYILDYMRDQQLVLPEHFPEQGRLQREAEFFNLPELVQLLAPKISKQNTLGDDGCQTDQD 134

  Fly   236 RVRNGNYLVAPPTPPARHIKTSPRTSASPECNYEVVALHISPDLGE------------RIMLSAE 288
            ....|..:....:....:......|:.|....:..:....|..||.            |||:..:
Zfish   135 ESSPGANITCNLSSLGAYSSLGAATADSQRSGFITIGCRGSYTLGRDCQTDAKFRRVARIMVCGK 199

  Fly   289 RALLDELFPEA-SQATQSSRSGVSWNQGDWGQIIRFPLNGYCKLNSV-QVLTRLLNAGFTIEA-- 349
            .:|..|:|.|. :::....|      |.|     |:....|.|..|: |...||.:|||.:.|  
Zfish   200 TSLAKEVFGETLNESHDPDR------QPD-----RYTSRYYLKFTSLEQAFDRLADAGFHMVACN 253

  Fly   350 SVGGQQFS 357
            |.|...|:
Zfish   254 STGTCAFA 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 33/94 (35%)
kctd12bXP_009305996.1 BTB 21..113 CDD:197585 33/92 (36%)
BTB 21..110 CDD:295341 33/89 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170591942
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2723
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.