DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment twz and KCTD5

DIOPT Version :10

Sequence 1:NP_001246449.1 Gene:twz / 37456 FlyBaseID:FBgn0034636 Length:367 Species:Drosophila melanogaster
Sequence 2:NP_061865.1 Gene:KCTD5 / 54442 HGNCID:21423 Length:234 Species:Homo sapiens


Alignment Length:238 Identity:64/238 - (26%)
Similarity:103/238 - (43%) Gaps:57/238 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 LPGAVAAAAAAVGGA----SSAGASSYLHGNHKPITGIPCVAAASRYTAPVHIDVGGTIYTSSLE 151
            |..|.....|.:||.    .|||..:..   .:|       .:.|::   |.::||||.:.::.:
Human     9 LSPARGGIGAGLGGGLCRRCSAGLGALA---QRP-------GSVSKW---VRLNVGGTYFLTTRQ 60

  Fly   152 TLTKYPESKLAKLFNGQIPIVLDSLKQH---YFIDRDGGMFRHILNFMRNSRLLIAEDFPDLELL 213
            ||.:.|:|.|.:|.  |....|||.|..   |.||||...|..:||::|:.:|:|.:|..: |.:
Human    61 TLCRDPKSFLYRLC--QADPDLDSDKDETGAYLIDRDPTYFGPVLNYLRHGKLVINKDLAE-EGV 122

  Fly   214 LEEARYYEVEPMIKQLESMRKDRVRNGNYLVAPPTPPARHIKTSPRTSASPECNYEVVALHISPD 278
            ||||.:|.:..:||    :.||::|.            |..|||           :|...|:   
Human   123 LEEAEFYNITSLIK----LVKDKIRE------------RDSKTS-----------QVPVKHV--- 157

  Fly   279 LGERIMLSAERAL--LDELFPEASQATQSSRSGVSWNQGDWGQ 319
              .|::...|..|  :.....:..:..|....|.|:|.|:..|
Human   158 --YRVLQCQEEELTQMVSTMSDGWKFEQLVSIGSSYNYGNEDQ 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
twzNP_001246449.1 BTB_POZ_KCTD1-like 137..230 CDD:349670 36/95 (38%)
KCTD5NP_061865.1 BTB_POZ_KCTD5 40..151 CDD:349698 44/143 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..234
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.